BLASTX nr result
ID: Paeonia25_contig00054618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054618 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 55 8e-06 ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 55 8e-06 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 55 8e-06 ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 55 8e-06 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 136 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVL 14 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL Sbjct: 765 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVL 805 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 136 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVL 14 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL Sbjct: 232 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVL 272 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 136 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVL 14 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL Sbjct: 239 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVL 279 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 136 ICLIPKKVNSSKVRDYGPNSFVTSLYKIIEKGLSSRFSRVL 14 ICLIPKK NS KV DY P S VTSLYK+I K L+SR VL Sbjct: 381 ICLIPKKANSVKVTDYRPISLVTSLYKVISKVLASRLREVL 421