BLASTX nr result
ID: Paeonia25_contig00054617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054617 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 82 6e-21 ref|XP_002534687.1| NADH-ubiquinone oxidoreductase chain, putati... 83 6e-17 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 63 4e-10 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 81.6 bits (200), Expect(2) = 6e-21 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 202 EGSGYLLELRPTTTGQFRFGATPYSTIIIGVWGSRQRKIK 321 E SGYLLELRPTTTG+FRFGATPYSTIIIGVWGSRQRKIK Sbjct: 316 ESSGYLLELRPTTTGKFRFGATPYSTIIIGVWGSRQRKIK 355 Score = 44.7 bits (104), Expect(2) = 6e-21 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 27 TGGHLPQCKQHCSPPPEKQKI 89 TGGHLPQ K HCSPPP+KQKI Sbjct: 294 TGGHLPQRKLHCSPPPDKQKI 314 >ref|XP_002534687.1| NADH-ubiquinone oxidoreductase chain, putative [Ricinus communis] gi|223524771|gb|EEF27701.1| NADH-ubiquinone oxidoreductase chain, putative [Ricinus communis] Length = 366 Score = 82.8 bits (203), Expect(2) = 6e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 196 P*EGSGYLLELRPTTTGQFRFGATPYSTIIIGVWGSRQRKIK 321 P +G GYLLELRPTTTGQFRFGATPYSTIIIGVWGSRQRKIK Sbjct: 23 PEKGVGYLLELRPTTTGQFRFGATPYSTIIIGVWGSRQRKIK 64 Score = 30.0 bits (66), Expect(2) = 6e-17 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 131 MTRAXXXXXXXXXXXXKSHVRFPEKGV 211 MTRA KSHVRFPEKGV Sbjct: 1 MTRADDGSSGRSRMMRKSHVRFPEKGV 27 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 62.8 bits (151), Expect(2) = 4e-10 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 118 YACIFGLDYQIFCFSGGGEQCCLHCGRCPPV 26 YAC+F LD +IFCFSGGGEQC L CGRCPPV Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPPV 269 Score = 26.9 bits (58), Expect(2) = 4e-10 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 149 RRRPLSLDHYLCMY 108 +R PLSLDHY C++ Sbjct: 230 KRGPLSLDHYACLF 243