BLASTX nr result
ID: Paeonia25_contig00053943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053943 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007138161.1| hypothetical protein PHAVU_009G185300g [Phas... 63 4e-08 ref|XP_004500015.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 6e-08 ref|XP_004491848.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 6e-08 emb|CBI15188.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002284602.1| PREDICTED: vesicle transport v-SNARE 13 [Vit... 62 6e-08 ref|XP_006494987.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 8e-08 ref|XP_006482638.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 8e-08 ref|XP_006431216.1| hypothetical protein CICLE_v10012700mg [Citr... 62 8e-08 ref|XP_007032615.1| Vesicle transport v-SNARE family protein [Th... 62 8e-08 ref|XP_004304273.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 8e-08 ref|XP_002530011.1| vesicle transport V-snare protein vti1a, put... 62 8e-08 ref|XP_006581020.1| PREDICTED: uncharacterized protein LOC100801... 62 1e-07 ref|XP_007151260.1| hypothetical protein PHAVU_004G031600g [Phas... 62 1e-07 ref|XP_007151259.1| hypothetical protein PHAVU_004G031600g [Phas... 62 1e-07 ref|XP_004236006.1| PREDICTED: vesicle transport v-SNARE 13-like... 62 1e-07 ref|NP_001274917.1| vesicle transport v-SNARE 13-like [Solanum t... 62 1e-07 gb|ABA40452.1| unknown [Solanum tuberosum] 62 1e-07 ref|XP_004489422.1| PREDICTED: vesicle transport v-SNARE 13-like... 61 1e-07 tpg|DAA45667.1| TPA: putative protein kinase superfamily protein... 61 2e-07 gb|AFK43800.1| unknown [Lotus japonicus] 61 2e-07 >ref|XP_007138161.1| hypothetical protein PHAVU_009G185300g [Phaseolus vulgaris] gi|561011248|gb|ESW10155.1| hypothetical protein PHAVU_009G185300g [Phaseolus vulgaris] Length = 221 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQP++KATLLAKLREYKTDLNN+ Sbjct: 52 IRKMDLEARSLQPSIKATLLAKLREYKTDLNNL 84 >ref|XP_004500015.1| PREDICTED: vesicle transport v-SNARE 13-like isoform X1 [Cicer arietinum] gi|502128604|ref|XP_004500016.1| PREDICTED: vesicle transport v-SNARE 13-like isoform X2 [Cicer arietinum] Length = 221 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQP++KATLLAKLREYKTDLNN+ Sbjct: 52 IRKMDLEARSLQPSMKATLLAKLREYKTDLNNL 84 >ref|XP_004491848.1| PREDICTED: vesicle transport v-SNARE 13-like isoform X1 [Cicer arietinum] gi|502101686|ref|XP_004491849.1| PREDICTED: vesicle transport v-SNARE 13-like isoform X2 [Cicer arietinum] Length = 221 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPN+KA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNIKAVLLAKLREYKSDLNNI 84 >emb|CBI15188.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQP+VKA LLAKLREYKTDLNNV Sbjct: 110 IRKMDLEARSLQPSVKAMLLAKLREYKTDLNNV 142 >ref|XP_002284602.1| PREDICTED: vesicle transport v-SNARE 13 [Vitis vinifera] Length = 221 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQP+VKA LLAKLREYKTDLNNV Sbjct: 52 IRKMDLEARSLQPSVKAMLLAKLREYKTDLNNV 84 >ref|XP_006494987.1| PREDICTED: vesicle transport v-SNARE 13-like [Citrus sinensis] Length = 221 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LL+KLREYKTDLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAMLLSKLREYKTDLNNL 84 >ref|XP_006482638.1| PREDICTED: vesicle transport v-SNARE 13-like [Citrus sinensis] Length = 221 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAVLLAKLREYKSDLNNL 84 >ref|XP_006431216.1| hypothetical protein CICLE_v10012700mg [Citrus clementina] gi|557533273|gb|ESR44456.1| hypothetical protein CICLE_v10012700mg [Citrus clementina] Length = 221 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAVLLAKLREYKSDLNNL 84 >ref|XP_007032615.1| Vesicle transport v-SNARE family protein [Theobroma cacao] gi|508711644|gb|EOY03541.1| Vesicle transport v-SNARE family protein [Theobroma cacao] Length = 221 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAVLLAKLREYKSDLNNL 84 >ref|XP_004304273.1| PREDICTED: vesicle transport v-SNARE 13-like [Fragaria vesca subsp. vesca] Length = 220 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAVLLAKLREYKSDLNNL 84 >ref|XP_002530011.1| vesicle transport V-snare protein vti1a, putative [Ricinus communis] gi|223530490|gb|EEF32373.1| vesicle transport V-snare protein vti1a, putative [Ricinus communis] Length = 220 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNVKA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVKAVLLAKLREYKSDLNNL 84 >ref|XP_006581020.1| PREDICTED: uncharacterized protein LOC100801744 isoform X3 [Glycine max] Length = 172 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 102 EIRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 EIRKMDLEARSLQP+VKA LLAKLREYKTDL+N+ Sbjct: 2 EIRKMDLEARSLQPSVKAALLAKLREYKTDLSNL 35 >ref|XP_007151260.1| hypothetical protein PHAVU_004G031600g [Phaseolus vulgaris] gi|561024569|gb|ESW23254.1| hypothetical protein PHAVU_004G031600g [Phaseolus vulgaris] Length = 181 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPN+KA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNIKAVLLAKLREYKSDLNNL 84 >ref|XP_007151259.1| hypothetical protein PHAVU_004G031600g [Phaseolus vulgaris] gi|561024568|gb|ESW23253.1| hypothetical protein PHAVU_004G031600g [Phaseolus vulgaris] Length = 221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPN+KA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNIKAVLLAKLREYKSDLNNL 84 >ref|XP_004236006.1| PREDICTED: vesicle transport v-SNARE 13-like [Solanum lycopersicum] Length = 221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSL PNVKATLLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLPPNVKATLLAKLREYKSDLNNL 84 >ref|NP_001274917.1| vesicle transport v-SNARE 13-like [Solanum tuberosum] gi|78191454|gb|ABB29948.1| vesicle transport v-SNARE 11-like [Solanum tuberosum] Length = 221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSL PNVKATLLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLPPNVKATLLAKLREYKSDLNNL 84 >gb|ABA40452.1| unknown [Solanum tuberosum] Length = 221 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSL PNVKATLLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLPPNVKATLLAKLREYKSDLNNL 84 >ref|XP_004489422.1| PREDICTED: vesicle transport v-SNARE 13-like [Cicer arietinum] Length = 221 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPN+KA LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNIKAMLLAKLREYKSDLNNL 84 >tpg|DAA45667.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 434 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 102 EIRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 +IRKMDLEARSLQP++KA LLAKLREYK+DLNNV Sbjct: 89 QIRKMDLEARSLQPSIKAGLLAKLREYKSDLNNV 122 >gb|AFK43800.1| unknown [Lotus japonicus] Length = 221 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 IRKMDLEARSLQPNVKATLLAKLREYKTDLNNV 1 IRKMDLEARSLQPNV+A LLAKLREYK+DLNN+ Sbjct: 52 IRKMDLEARSLQPNVRAVLLAKLREYKSDLNNL 84