BLASTX nr result
ID: Paeonia25_contig00053806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053806 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004514248.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_007042573.1| Pentatricopeptide repeat-containing protein ... 86 5e-15 ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-15 ref|XP_007143083.1| hypothetical protein PHAVU_007G042100g [Phas... 77 3e-12 ref|XP_004243818.1| PREDICTED: putative pentatricopeptide repeat... 74 2e-11 ref|XP_006348971.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 ref|XP_003607763.1| Pentatricopeptide repeat-containing protein ... 65 1e-08 ref|XP_007199641.1| hypothetical protein PRUPE_ppa021613mg [Prun... 62 8e-08 gb|EYU40098.1| hypothetical protein MIMGU_mgv1a018468mg, partial... 62 1e-07 gb|EPS71925.1| hypothetical protein M569_02834, partial [Genlise... 56 6e-06 >ref|XP_004514248.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Cicer arietinum] Length = 1334 Score = 91.3 bits (225), Expect = 1e-16 Identities = 49/77 (63%), Positives = 53/77 (68%) Frame = +3 Query: 99 KFKTCFSFHIVLQLMRSLSSNPAFPKLSNLSVLLQGHISRSHLLQIHARVFLLGAHQDNL 278 K K C S I L RS SS NL+ LLQGH+S HLLQIHAR+F +GAHQDNL Sbjct: 710 KLKHCSSSVIALLHSRSSSSTADPTNFQNLAALLQGHLSVPHLLQIHARIFQVGAHQDNL 769 Query: 279 IATRLIGHYPSRFALPV 329 IATRLIGHYPSR AL V Sbjct: 770 IATRLIGHYPSRIALRV 786 >ref|XP_007042573.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] gi|508706508|gb|EOX98404.1| Pentatricopeptide repeat-containing protein [Theobroma cacao] Length = 647 Score = 85.9 bits (211), Expect = 5e-15 Identities = 50/99 (50%), Positives = 63/99 (63%), Gaps = 1/99 (1%) Frame = +3 Query: 36 RKRSLIYPTMLLFFQRSPVHLKFKTCFSFHI-VLQLMRSLSSNPAFPKLSNLSVLLQGHI 212 R++SL+ ML Q+ ++ T I ++ + SLSS + NLS+LLQG I Sbjct: 8 RRQSLVSSAMLRSCQQFSAAFRYFTLSPSSIFAVEFLHSLSSTSS-SNFHNLSLLLQGRI 66 Query: 213 SRSHLLQIHARVFLLGAHQDNLIATRLIGHYPSRFALPV 329 SHL QIHAR+F L AHQDNL+ATRLIGHYPS FAL V Sbjct: 67 LHSHLRQIHARIFRLNAHQDNLVATRLIGHYPSSFALRV 105 >ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 634 Score = 85.5 bits (210), Expect = 7e-15 Identities = 51/78 (65%), Positives = 56/78 (71%) Frame = +3 Query: 96 LKFKTCFSFHIVLQLMRSLSSNPAFPKLSNLSVLLQGHISRSHLLQIHARVFLLGAHQDN 275 LKFK IV L S + A P +NL+ LLQG+I RSHLLQIHAR+F LGAHQDN Sbjct: 16 LKFKP-----IVALLHSPSSCSIADP--TNLATLLQGNIPRSHLLQIHARIFYLGAHQDN 68 Query: 276 LIATRLIGHYPSRFALPV 329 LIATRLIGHYPSR AL V Sbjct: 69 LIATRLIGHYPSRAALRV 86 >ref|XP_007143083.1| hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] gi|561016273|gb|ESW15077.1| hypothetical protein PHAVU_007G042100g [Phaseolus vulgaris] Length = 632 Score = 76.6 bits (187), Expect = 3e-12 Identities = 42/68 (61%), Positives = 50/68 (73%) Frame = +3 Query: 126 IVLQLMRSLSSNPAFPKLSNLSVLLQGHISRSHLLQIHARVFLLGAHQDNLIATRLIGHY 305 IV L SS+ A P +NL+ LLQG++ S+L QIH R+F LGAHQDNL+ATRLIGHY Sbjct: 19 IVALLHSRCSSSIAEP--TNLATLLQGNLPYSYLHQIHTRIFQLGAHQDNLVATRLIGHY 76 Query: 306 PSRFALPV 329 PSR AL V Sbjct: 77 PSRIALRV 84 >ref|XP_004243818.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Solanum lycopersicum] Length = 627 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/69 (57%), Positives = 47/69 (68%) Frame = +3 Query: 123 HIVLQLMRSLSSNPAFPKLSNLSVLLQGHISRSHLLQIHARVFLLGAHQDNLIATRLIGH 302 H L RS SS S+L LL+G I+ +HL QIHARVF +GAHQDNLIATRLIG Sbjct: 19 HYCLNFTRSFSSTSDLHS-SSLWNLLKGRITHNHLRQIHARVFRIGAHQDNLIATRLIGQ 77 Query: 303 YPSRFALPV 329 YPS F+L + Sbjct: 78 YPSNFSLRI 86 >ref|XP_006348971.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Solanum tuberosum] Length = 627 Score = 73.6 bits (179), Expect = 3e-11 Identities = 40/69 (57%), Positives = 46/69 (66%) Frame = +3 Query: 123 HIVLQLMRSLSSNPAFPKLSNLSVLLQGHISRSHLLQIHARVFLLGAHQDNLIATRLIGH 302 H L RS SS S+L LL+G IS +HL QIHARVF +GAHQDNLIATRLIG Sbjct: 19 HYCLNFTRSFSSTSDLHS-SSLCNLLKGRISHNHLKQIHARVFRIGAHQDNLIATRLIGQ 77 Query: 303 YPSRFALPV 329 YPS +L + Sbjct: 78 YPSNISLRI 86 >ref|XP_003607763.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508818|gb|AES89960.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 871 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +3 Query: 162 PAFPKLSNL----SVLLQGHISRSHLLQIHARVFLLGAHQDNLIATRLIGHYPSRFALPV 329 P F LS + LQGH+S HLLQIHA +F GAHQ NLIATRLIGHY S+ L V Sbjct: 714 PTFHPLSQILPTSKTSLQGHLSLPHLLQIHAHIFQFGAHQHNLIATRLIGHYISQIDLCV 773 >ref|XP_007199641.1| hypothetical protein PRUPE_ppa021613mg [Prunus persica] gi|462395041|gb|EMJ00840.1| hypothetical protein PRUPE_ppa021613mg [Prunus persica] Length = 643 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = +3 Query: 204 GHISRSHLLQIHARVFLLGAHQDNLIATRLIGHYPSRFALPV 329 G IS LLQIHA+VF +GA QDNLIATRLIGHYPS AL V Sbjct: 60 GRISYPRLLQIHAQVFQVGAQQDNLIATRLIGHYPSHLALRV 101 >gb|EYU40098.1| hypothetical protein MIMGU_mgv1a018468mg, partial [Mimulus guttatus] Length = 278 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 201 QGHISRSHLLQIHARVFLLGAHQDNLIATRLIGHYPSRFALPV 329 Q I R+HLLQ+HA +F L AHQ NLIATRLIGHY S FA+ V Sbjct: 40 QARIPRAHLLQLHASIFRLNAHQSNLIATRLIGHYHSNFAVRV 82 >gb|EPS71925.1| hypothetical protein M569_02834, partial [Genlisea aurea] Length = 583 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 195 LLQGHISRSHLLQIHARVFLLGAHQDNLIATRLIGHYPSRFALPV 329 LL+G I R LL+IH RVF + +D+L+ATRLIGHYP++ AL V Sbjct: 1 LLRGRICRRRLLEIHGRVFRMDVQEDDLVATRLIGHYPAKPALGV 45