BLASTX nr result
ID: Paeonia25_contig00053685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053685 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503478.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_004503478.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10270-like [Cicer arietinum] Length = 880 Score = 55.8 bits (133), Expect = 6e-06 Identities = 39/111 (35%), Positives = 51/111 (45%), Gaps = 5/111 (4%) Frame = +3 Query: 15 SAAFITAQTLSHKCRSRDLHSCRLLQSHTDSTPIGPRINVHHTNESNV-----KVDFFID 179 S AF +A+ + R R R L+ I P HH+ + N + Sbjct: 26 SFAFSSAEEAAAVRRQRK----RRLRIEPPLNAIRPPPQQHHSRDPNAPRLPDSTSALVG 81 Query: 180 PSRSLHNHIQSLISDGKLDEASGAARRSVLCNIYPYVCTCNEIMRAMFEAE 332 P +LHN +QSLI G LD AS AR SV P V TCN I+ AM+ A+ Sbjct: 82 PRLNLHNRVQSLIRAGDLDAASAIARHSVFSMTRPTVFTCNAIIAAMYRAK 132