BLASTX nr result
ID: Paeonia25_contig00053287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053287 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517531.1| Boron transporter, putative [Ricinus communi... 62 8e-08 emb|CAN61936.1| hypothetical protein VITISV_001012 [Vitis vinifera] 59 9e-07 ref|XP_002281778.2| PREDICTED: boron transporter 4-like [Vitis v... 58 1e-06 ref|XP_002517565.1| Boron transporter, putative [Ricinus communi... 55 8e-06 >ref|XP_002517531.1| Boron transporter, putative [Ricinus communis] gi|223543163|gb|EEF44695.1| Boron transporter, putative [Ricinus communis] Length = 647 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 453 DKELSCSGNEEMCDAEILDELTTRRGEFKLRSLSFPKEGHSQVHP 319 ++E SC GNEE+ DAE+LDELTT RGE K+R+LSF KE QV+P Sbjct: 595 EEEGSCVGNEELFDAEMLDELTTSRGELKVRTLSFRKENRGQVYP 639 >emb|CAN61936.1| hypothetical protein VITISV_001012 [Vitis vinifera] Length = 690 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 432 GNEEMCDAEILDELTTRRGEFKLRSLSFPKEGHSQVHPNVSAE 304 G E+CDAEILDELTT RGE KLRSLS P + SQVHP E Sbjct: 639 GEVEICDAEILDELTTSRGELKLRSLSCPADWISQVHPKXBEE 681 >ref|XP_002281778.2| PREDICTED: boron transporter 4-like [Vitis vinifera] gi|297738904|emb|CBI28149.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 432 GNEEMCDAEILDELTTRRGEFKLRSLSFPKEGHSQVHPNVSAE 304 G E+CDAEILDELTT RGE KLRSLS P + SQVHP E Sbjct: 624 GEVEICDAEILDELTTSRGELKLRSLSCPADWISQVHPKKDEE 666 >ref|XP_002517565.1| Boron transporter, putative [Ricinus communis] gi|223543197|gb|EEF44729.1| Boron transporter, putative [Ricinus communis] Length = 670 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = -3 Query: 453 DKELSCSGNEE----MCDAEILDELTTRRGEFKLRSLSFPKEGHSQVHPNVSAE 304 +KE GNEE +CDAE+LDELTT RGEFK+R++SF +E QV+P E Sbjct: 614 EKEGGGLGNEEGKVEVCDAEMLDELTTSRGEFKVRTVSFHEENRGQVYPEEIVE 667