BLASTX nr result
ID: Paeonia25_contig00053286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053286 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047786.1| Basic helix-loop-helix DNA-binding superfami... 57 3e-06 ref|XP_006426267.1| hypothetical protein CICLE_v10024755mg [Citr... 57 4e-06 ref|XP_006466314.1| PREDICTED: uncharacterized protein At4g38062... 56 5e-06 >ref|XP_007047786.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] gi|590706671|ref|XP_007047787.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700047|gb|EOX91943.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700048|gb|EOX91944.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1176 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -3 Query: 223 NKELRSPLKELQEARIHEAGSASSLGEL*NKLINLEQMHRECS 95 N+EL + ++ELQEAR EAGS+SSL +L NKL ++EQMH+ECS Sbjct: 329 NQELMTSVRELQEARFQEAGSSSSLSKLKNKLKSVEQMHKECS 371 >ref|XP_006426267.1| hypothetical protein CICLE_v10024755mg [Citrus clementina] gi|557528257|gb|ESR39507.1| hypothetical protein CICLE_v10024755mg [Citrus clementina] Length = 1111 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 223 NKELRSPLKELQEARIHEAGSASSLGEL*NKLINLEQMHRECS 95 N+EL LKELQEA+I +AGS+SSL +L NKL ++EQMHR+CS Sbjct: 327 NQELLMSLKELQEAQIQKAGSSSSLAKLRNKLRSVEQMHRDCS 369 >ref|XP_006466314.1| PREDICTED: uncharacterized protein At4g38062-like [Citrus sinensis] Length = 1111 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 223 NKELRSPLKELQEARIHEAGSASSLGEL*NKLINLEQMHRECS 95 N+EL LKELQEA+I +AGS+SSL +L NKL ++EQMHR+CS Sbjct: 327 NQELLMSLKELQEAQIQKAGSSSSLAKLRNKLGSVEQMHRDCS 369