BLASTX nr result
ID: Paeonia25_contig00053186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053186 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515266.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002515266.1| conserved hypothetical protein [Ricinus communis] gi|223545746|gb|EEF47250.1| conserved hypothetical protein [Ricinus communis] Length = 282 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/72 (44%), Positives = 43/72 (59%) Frame = -2 Query: 234 LVLVRALAFPSSFSHRPFLPKQHHRNLSFHIACSSHESDSIKPIGTALRAEYKPGAFDQL 55 L L+R L+ S R LP+ +R SF I+CSS +S+ K R+EYKPG FD Sbjct: 23 LALLRPLSISVSPPSRLKLPRLFNR--SFRISCSSLQSEPEKTEDVGTRSEYKPGFFDDF 80 Query: 54 FMSLFRRKMVEQ 19 F++LFR KMV + Sbjct: 81 FLTLFRNKMVAE 92