BLASTX nr result
ID: Paeonia25_contig00053165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053165 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD38185.1| hypothetical protein CERSUDRAFT_113336 [Ceriporio... 56 4e-06 >gb|EMD38185.1| hypothetical protein CERSUDRAFT_113336 [Ceriporiopsis subvermispora B] Length = 1207 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/41 (53%), Positives = 33/41 (80%) Frame = -2 Query: 124 MELTLSRVDYEANVWEVKRAIATVLHGDDFFDSSDPKARPI 2 ME+ L V ++A VW+VKRA+ TV HG+DF+++SDP+ RP+ Sbjct: 1 MEIELKDVAFDATVWDVKRALETVFHGEDFYNASDPRERPL 41