BLASTX nr result
ID: Paeonia25_contig00053121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053121 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218981.1| hypothetical protein PRUPE_ppa003968mg [Prun... 72 6e-11 ref|XP_007139395.1| hypothetical protein PHAVU_008G025900g [Phas... 70 2e-10 ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002313416.2| chlororespiratory reduction 2 family protein... 69 5e-10 ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 gb|EEC71803.1| hypothetical protein OsI_04433 [Oryza sativa Indi... 69 9e-10 ref|NP_001044803.1| Os01g0848300 [Oryza sativa Japonica Group] g... 69 9e-10 ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] 68 1e-09 ref|XP_006646479.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_006493448.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004307227.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_007219518.1| hypothetical protein PRUPE_ppa022511mg [Prun... 67 2e-09 gb|EMT16873.1| hypothetical protein F775_05434 [Aegilops tauschii] 67 3e-09 ref|XP_004491940.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_006427693.1| hypothetical protein CICLE_v10025096mg [Citr... 65 7e-09 ref|XP_004972250.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 emb|CBI16054.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_001774871.1| predicted protein [Physcomitrella patens] gi... 65 1e-08 >ref|XP_007218981.1| hypothetical protein PRUPE_ppa003968mg [Prunus persica] gi|462415443|gb|EMJ20180.1| hypothetical protein PRUPE_ppa003968mg [Prunus persica] Length = 537 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFADRE+LVRDVNR HHFRDGVCSCGDYW Sbjct: 506 FISKFADREILVRDVNRFHHFRDGVCSCGDYW 537 >ref|XP_007139395.1| hypothetical protein PHAVU_008G025900g [Phaseolus vulgaris] gi|561012528|gb|ESW11389.1| hypothetical protein PHAVU_008G025900g [Phaseolus vulgaris] Length = 658 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA+RE+LVRDVNR HHFRDGVCSCGDYW Sbjct: 627 FISKFANREILVRDVNRFHHFRDGVCSCGDYW 658 >ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA+RE+LVRDVNR HHFRDGVCSCGDYW Sbjct: 627 FISKFANREILVRDVNRFHHFRDGVCSCGDYW 658 >ref|XP_002313416.2| chlororespiratory reduction 2 family protein [Populus trichocarpa] gi|550331005|gb|EEE87371.2| chlororespiratory reduction 2 family protein [Populus trichocarpa] Length = 650 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA++E+LVRDVNR HHFRDGVCSCGDYW Sbjct: 619 FISKFANKEILVRDVNRFHHFRDGVCSCGDYW 650 >ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449474033|ref|XP_004154055.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449510921|ref|XP_004163811.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] Length = 649 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFADRE++VRD+NR HHF+DGVCSCGDYW Sbjct: 618 FISKFADREIMVRDLNRFHHFKDGVCSCGDYW 649 >ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA+RE+LVRDVNR HHF+DGVCSCGDYW Sbjct: 627 FISKFANREILVRDVNRFHHFKDGVCSCGDYW 658 >gb|EEC71803.1| hypothetical protein OsI_04433 [Oryza sativa Indica Group] Length = 437 Score = 68.6 bits (166), Expect = 9e-10 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISK+A+RE++VRDVNR HHFRDG+CSCGDYW Sbjct: 406 FISKYAEREIIVRDVNRFHHFRDGICSCGDYW 437 >ref|NP_001044803.1| Os01g0848300 [Oryza sativa Japonica Group] gi|15408890|dbj|BAB64281.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113534334|dbj|BAF06717.1| Os01g0848300 [Oryza sativa Japonica Group] gi|125572632|gb|EAZ14147.1| hypothetical protein OsJ_04076 [Oryza sativa Japonica Group] Length = 660 Score = 68.6 bits (166), Expect = 9e-10 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISK+A+RE++VRDVNR HHFRDG+CSCGDYW Sbjct: 629 FISKYAEREIIVRDVNRFHHFRDGICSCGDYW 660 >ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Brachypodium distachyon] Length = 654 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKF +RE++VRDVNR HHFRDGVCSCGDYW Sbjct: 623 FISKFTEREIVVRDVNRFHHFRDGVCSCGDYW 654 >gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] Length = 659 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKF +RE++VRDVNR HHFRDGVCSCGDYW Sbjct: 628 FISKFVNREIVVRDVNRFHHFRDGVCSCGDYW 659 >ref|XP_006646479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Oryza brachyantha] Length = 572 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISK+ +RE++VRDVNR HHFRDGVCSCGDYW Sbjct: 541 FISKYTEREIIVRDVNRFHHFRDGVCSCGDYW 572 >ref|XP_006493448.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Citrus sinensis] Length = 662 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA++E+LVRDVNR HHFR+GVCSCGDYW Sbjct: 631 FISKFANKEILVRDVNRFHHFRNGVCSCGDYW 662 >ref|XP_004307227.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 776 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FIS+F +RE+LVRDVNR HHFRDG+CSCGDYW Sbjct: 745 FISRFTNREILVRDVNRFHHFRDGICSCGDYW 776 >ref|XP_007219518.1| hypothetical protein PRUPE_ppa022511mg [Prunus persica] gi|462415980|gb|EMJ20717.1| hypothetical protein PRUPE_ppa022511mg [Prunus persica] Length = 152 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFADR++LV+DVN HHFRDGVCSCGDYW Sbjct: 121 FISKFADRKILVQDVNHFHHFRDGVCSCGDYW 152 >gb|EMT16873.1| hypothetical protein F775_05434 [Aegilops tauschii] Length = 527 Score = 66.6 bits (161), Expect = 3e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKF +RE++V+DVNR HHFRDG+CSCGDYW Sbjct: 496 FISKFTEREIVVKDVNRFHHFRDGICSCGDYW 527 >ref|XP_004491940.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cicer arietinum] Length = 661 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA RE+L+RDVNR H+FRDGVCSCGDYW Sbjct: 630 FISKFAKREILLRDVNRFHYFRDGVCSCGDYW 661 >ref|XP_006427693.1| hypothetical protein CICLE_v10025096mg [Citrus clementina] gi|557529683|gb|ESR40933.1| hypothetical protein CICLE_v10025096mg [Citrus clementina] Length = 662 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKFA++E+LVRDVNR HHF +GVCSCGDYW Sbjct: 631 FISKFANKEILVRDVNRFHHFHNGVCSCGDYW 662 >ref|XP_004972250.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Setaria italica] Length = 657 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISKF +RE++VRDVNR HHFRDGVCSC DYW Sbjct: 626 FISKFTEREIIVRDVNRFHHFRDGVCSCRDYW 657 >emb|CBI16054.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW*SLPK 315 FISKFA+RE+LVRDVNR H F+DGVCSCGDYW L K Sbjct: 437 FISKFANREILVRDVNRFHLFQDGVCSCGDYWYMLMK 473 >ref|XP_001774871.1| predicted protein [Physcomitrella patens] gi|162673765|gb|EDQ60283.1| predicted protein [Physcomitrella patens] Length = 902 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 425 FISKFADRELLVRDVNRIHHFRDGVCSCGDYW 330 FISK DRE++ RDVNR HHF+DGVCSCGDYW Sbjct: 871 FISKIVDREIIARDVNRFHHFKDGVCSCGDYW 902