BLASTX nr result
ID: Paeonia25_contig00053102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053102 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD30561.1| hypothetical protein CERSUDRAFT_127786, partial [... 61 2e-07 >gb|EMD30561.1| hypothetical protein CERSUDRAFT_127786, partial [Ceriporiopsis subvermispora B] Length = 536 Score = 60.8 bits (146), Expect = 2e-07 Identities = 38/72 (52%), Positives = 47/72 (65%) Frame = -2 Query: 217 RTLDEKDDGLLHRSSLIRASPTGASPRDESTLAKWRSNTGSTMGTTLPPISSSPAVRTNP 38 R+ DE D + HRSS+ + SP G PRD+ + K RS T S+ TLP ISSS A+RTNP Sbjct: 254 RSTDE-DTIVFHRSSIGKQSPVGTPPRDDGSFGKRRSGTLSS-SVTLPLISSS-ALRTNP 310 Query: 37 SKLLASVPYVQS 2 SK S+PY QS Sbjct: 311 SKPQPSIPYTQS 322