BLASTX nr result
ID: Paeonia25_contig00053099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053099 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT05221.1| hypothetical protein FOMPIDRAFT_1111746 [Fomitops... 59 5e-07 >gb|EPT05221.1| hypothetical protein FOMPIDRAFT_1111746 [Fomitopsis pinicola FP-58527 SS1] Length = 556 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 2/100 (2%) Frame = +1 Query: 1 CQGAPLLQELNLMYDHTMEDVMTSSSWIPFTKQDFTIFEGNFPRLATLRLDGAIFDWPRY 180 C GAPLL+ L L + ED + + +QDF +F G+ PRL + L G DW R Sbjct: 203 CAGAPLLEVLQLYHYEDSEDGAEAFAPAKHKQQDFVLFHGHAPRLTHVALWGVHLDWARS 262 Query: 181 HSIPTLTHLTLS--KLDICPTYHEFALLLSSAPQLKDLFL 294 + L L L+ D+ P Y +FA +L +P ++ L L Sbjct: 263 TFLRGLAELELAYHAKDVWPPYRDFARILRDSPAIETLTL 302