BLASTX nr result
ID: Paeonia25_contig00053083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00053083 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34248.1| hypothetical protein CERSUDRAFT_86374 [Ceriporiop... 62 8e-08 >gb|EMD34248.1| hypothetical protein CERSUDRAFT_86374 [Ceriporiopsis subvermispora B] Length = 124 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 169 SGNFTDFDGNVIASVVPLTDVDDGYVSYSGIFYVDTQFLVSW-DDGHLGYLHTMGVG 2 SGN +D GN++A+VVP T DDG VS SG F+ D + + W DG L YLH GVG Sbjct: 58 SGNLSDTSGNLVATVVPNTSADDGVVSASGTFFPDAKATLQWIVDGELAYLHMQGVG 114