BLASTX nr result
ID: Paeonia25_contig00052785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00052785 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29847.3| unnamed protein product [Vitis vinifera] 82 8e-14 ref|XP_002529610.1| ATP binding protein, putative [Ricinus commu... 82 8e-14 ref|XP_002278051.1| PREDICTED: leucine-rich repeat receptor-like... 82 8e-14 ref|XP_006489937.1| PREDICTED: leucine-rich repeat receptor-like... 82 1e-13 ref|XP_006421411.1| hypothetical protein CICLE_v100042991mg, par... 82 1e-13 ref|XP_007028773.1| Leucine-rich repeat protein kinase family pr... 81 2e-13 ref|XP_007028772.1| Leucine-rich repeat protein kinase family pr... 81 2e-13 ref|XP_007204661.1| hypothetical protein PRUPE_ppa001174mg [Prun... 80 2e-13 ref|XP_002308032.2| leucine-rich repeat transmembrane protein ki... 80 3e-13 ref|XP_002323316.2| leucine-rich repeat transmembrane protein ki... 80 4e-13 ref|XP_007162226.1| hypothetical protein PHAVU_001G134600g [Phas... 79 5e-13 gb|EPS68492.1| hypothetical protein M569_06271, partial [Genlise... 79 7e-13 ref|XP_006293653.1| hypothetical protein CARUB_v10022610mg [Caps... 79 7e-13 ref|XP_002879954.1| hypothetical protein ARALYDRAFT_483263 [Arab... 79 7e-13 dbj|BAF00244.1| putative receptor-like protein kinase [Arabidops... 79 7e-13 ref|NP_181713.1| leucine-rich repeat receptor-like tyrosine-prot... 79 7e-13 ref|XP_006350199.1| PREDICTED: leucine-rich repeat receptor-like... 79 9e-13 ref|XP_004236615.1| PREDICTED: leucine-rich repeat receptor-like... 79 9e-13 ref|XP_004163697.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich... 79 9e-13 ref|XP_004149404.1| PREDICTED: leucine-rich repeat receptor-like... 79 9e-13 >emb|CBI29847.3| unnamed protein product [Vitis vinifera] Length = 806 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF+WRKEML+ALKVALLCTD TPAKRPKMKKVVEMLQEIKQN Sbjct: 765 SFAWRKEMLSALKVALLCTDNTPAKRPKMKKVVEMLQEIKQN 806 >ref|XP_002529610.1| ATP binding protein, putative [Ricinus communis] gi|223530895|gb|EEF32755.1| ATP binding protein, putative [Ricinus communis] Length = 715 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WR+EMLAALKVALLCTD+TPAKRPKMKKVVEMLQEIKQN Sbjct: 674 SFGWRREMLAALKVALLCTDSTPAKRPKMKKVVEMLQEIKQN 715 >ref|XP_002278051.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 [Vitis vinifera] gi|147777287|emb|CAN69090.1| hypothetical protein VITISV_009158 [Vitis vinifera] Length = 887 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF+WRKEML+ALKVALLCTD TPAKRPKMKKVVEMLQEIKQN Sbjct: 846 SFAWRKEMLSALKVALLCTDNTPAKRPKMKKVVEMLQEIKQN 887 >ref|XP_006489937.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Citrus sinensis] Length = 888 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEML ALKVALLCTD+TPAKRPKMKKVVEMLQEIKQN Sbjct: 847 SFGWRKEMLTALKVALLCTDSTPAKRPKMKKVVEMLQEIKQN 888 >ref|XP_006421411.1| hypothetical protein CICLE_v100042991mg, partial [Citrus clementina] gi|557523284|gb|ESR34651.1| hypothetical protein CICLE_v100042991mg, partial [Citrus clementina] Length = 500 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEML ALKVALLCTD+TPAKRPKMKKVVEMLQEIKQN Sbjct: 459 SFGWRKEMLTALKVALLCTDSTPAKRPKMKKVVEMLQEIKQN 500 >ref|XP_007028773.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma cacao] gi|508717378|gb|EOY09275.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma cacao] Length = 660 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WR+EMLAALKVALLCTD+TPAKRPKMKKVVEMLQEI+QN Sbjct: 619 SFGWRREMLAALKVALLCTDSTPAKRPKMKKVVEMLQEIRQN 660 >ref|XP_007028772.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] gi|508717377|gb|EOY09274.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma cacao] Length = 888 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WR+EMLAALKVALLCTD+TPAKRPKMKKVVEMLQEI+QN Sbjct: 847 SFGWRREMLAALKVALLCTDSTPAKRPKMKKVVEMLQEIRQN 888 >ref|XP_007204661.1| hypothetical protein PRUPE_ppa001174mg [Prunus persica] gi|462400192|gb|EMJ05860.1| hypothetical protein PRUPE_ppa001174mg [Prunus persica] Length = 888 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEMLAALK+ALLCTD+ PAKRPKMKKVVEMLQEIKQN Sbjct: 847 SFGWRKEMLAALKIALLCTDSIPAKRPKMKKVVEMLQEIKQN 888 >ref|XP_002308032.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550335491|gb|EEE91555.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 887 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WR+EMLAALKVALLCTD+TPAKRPKMKKVVEMLQEIKQ+ Sbjct: 846 SFGWRREMLAALKVALLCTDSTPAKRPKMKKVVEMLQEIKQS 887 >ref|XP_002323316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550320905|gb|EEF05077.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 888 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQ 185 SF WR+EMLAALKVALLCTD+TPAKRPKMKKVVEMLQEIKQ Sbjct: 847 SFGWRREMLAALKVALLCTDSTPAKRPKMKKVVEMLQEIKQ 887 >ref|XP_007162226.1| hypothetical protein PHAVU_001G134600g [Phaseolus vulgaris] gi|561035690|gb|ESW34220.1| hypothetical protein PHAVU_001G134600g [Phaseolus vulgaris] Length = 887 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEMLAALKVALLCTD TPAKRPKMK VVEML+EIKQN Sbjct: 846 SFGWRKEMLAALKVALLCTDNTPAKRPKMKNVVEMLREIKQN 887 >gb|EPS68492.1| hypothetical protein M569_06271, partial [Genlisea aurea] Length = 814 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SFSWRKEMLAALK+ALLCTD +PAKRPKM+ VVEMLQEIKQN Sbjct: 771 SFSWRKEMLAALKIALLCTDNSPAKRPKMQNVVEMLQEIKQN 812 >ref|XP_006293653.1| hypothetical protein CARUB_v10022610mg [Capsella rubella] gi|482562361|gb|EOA26551.1| hypothetical protein CARUB_v10022610mg [Capsella rubella] Length = 890 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQ 185 SF+WR+EMLAALKVALLCTD TPAKRPKMKKVVEMLQE+KQ Sbjct: 848 SFAWRREMLAALKVALLCTDITPAKRPKMKKVVEMLQEVKQ 888 >ref|XP_002879954.1| hypothetical protein ARALYDRAFT_483263 [Arabidopsis lyrata subsp. lyrata] gi|297325793|gb|EFH56213.1| hypothetical protein ARALYDRAFT_483263 [Arabidopsis lyrata subsp. lyrata] Length = 891 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQ 185 SF+WR+EMLAALKVALLCTD TPAKRPKMKKVVEMLQE+KQ Sbjct: 849 SFAWRREMLAALKVALLCTDITPAKRPKMKKVVEMLQEVKQ 889 >dbj|BAF00244.1| putative receptor-like protein kinase [Arabidopsis thaliana] Length = 890 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQ 185 SF+WR+EMLAALKVALLCTD TPAKRPKMKKVVEMLQE+KQ Sbjct: 848 SFAWRREMLAALKVALLCTDITPAKRPKMKKVVEMLQEVKQ 888 >ref|NP_181713.1| leucine-rich repeat receptor-like tyrosine-protein kinase [Arabidopsis thaliana] gi|75097645|sp|O22938.1|Y2182_ARATH RecName: Full=Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820; Flags: Precursor gi|2335097|gb|AAC02766.1| putative receptor-like protein kinase [Arabidopsis thaliana] gi|224589547|gb|ACN59307.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|330254942|gb|AEC10036.1| leucine-rich repeat receptor-like tyrosine-protein kinase [Arabidopsis thaliana] Length = 890 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQ 185 SF+WR+EMLAALKVALLCTD TPAKRPKMKKVVEMLQE+KQ Sbjct: 848 SFAWRREMLAALKVALLCTDITPAKRPKMKKVVEMLQEVKQ 888 >ref|XP_006350199.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Solanum tuberosum] Length = 894 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SFSWRKEMLAALKVALLCTD TPAKRPKMKKVVEMLQEI ++ Sbjct: 853 SFSWRKEMLAALKVALLCTDMTPAKRPKMKKVVEMLQEITES 894 >ref|XP_004236615.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Solanum lycopersicum] Length = 894 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SFSWRKEMLAALKVALLCTD TPAKRPKMKKVVEMLQEI ++ Sbjct: 853 SFSWRKEMLAALKVALLCTDMTPAKRPKMKKVVEMLQEITES 894 >ref|XP_004163697.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Cucumis sativus] Length = 892 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEMLAALK+ALLCTD+ PAKRPKMKKVVEML EIKQN Sbjct: 851 SFGWRKEMLAALKIALLCTDSIPAKRPKMKKVVEMLSEIKQN 892 >ref|XP_004149404.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Cucumis sativus] Length = 892 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 307 SFSWRKEMLAALKVALLCTDTTPAKRPKMKKVVEMLQEIKQN 182 SF WRKEMLAALK+ALLCTD+ PAKRPKMKKVVEML EIKQN Sbjct: 851 SFGWRKEMLAALKIALLCTDSIPAKRPKMKKVVEMLSEIKQN 892