BLASTX nr result
ID: Paeonia25_contig00052651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00052651 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308609.1| PREDICTED: integrator complex subunit 9-like... 68 1e-09 ref|XP_007160012.1| hypothetical protein PHAVU_002G285400g [Phas... 65 1e-08 ref|XP_004515567.1| PREDICTED: integrator complex subunit 9-like... 65 1e-08 ref|XP_004512875.1| PREDICTED: integrator complex subunit 9-like... 65 1e-08 ref|XP_006347623.1| PREDICTED: integrator complex subunit 9-like... 63 5e-08 ref|XP_006591184.1| PREDICTED: integrator complex subunit 9-like... 62 6e-08 ref|XP_006591173.1| PREDICTED: integrator complex subunit 9-like... 62 6e-08 ref|XP_007220221.1| hypothetical protein PRUPE_ppa002193mg [Prun... 62 6e-08 ref|XP_004235291.1| PREDICTED: integrator complex subunit 9 homo... 62 8e-08 ref|XP_006407828.1| hypothetical protein EUTSA_v10020176mg [Eutr... 61 1e-07 ref|XP_006407827.1| hypothetical protein EUTSA_v10020176mg [Eutr... 61 1e-07 ref|XP_003598666.1| Integrator complex subunit [Medicago truncat... 61 1e-07 ref|XP_002882534.1| hypothetical protein ARALYDRAFT_896920 [Arab... 61 1e-07 ref|XP_006385160.1| hypothetical protein POPTR_0004s24410g [Popu... 61 2e-07 ref|XP_002520390.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 gb|EYU45766.1| hypothetical protein MIMGU_mgv1a002829mg [Mimulus... 60 2e-07 ref|NP_187409.2| uncharacterized protein [Arabidopsis thaliana]... 60 4e-07 gb|EPS67339.1| hypothetical protein M569_07435 [Genlisea aurea] 59 5e-07 ref|XP_002265081.2| PREDICTED: integrator complex subunit 9 homo... 59 5e-07 ref|XP_006297090.1| hypothetical protein CARUB_v10013093mg [Caps... 59 7e-07 >ref|XP_004308609.1| PREDICTED: integrator complex subunit 9-like [Fragaria vesca subsp. vesca] Length = 705 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKG G+HFPPC+ILDICGFR+LLDC Sbjct: 1 MKFTCLSKGGGYHFPPCHILDICGFRILLDC 31 >ref|XP_007160012.1| hypothetical protein PHAVU_002G285400g [Phaseolus vulgaris] gi|561033427|gb|ESW32006.1| hypothetical protein PHAVU_002G285400g [Phaseolus vulgaris] Length = 698 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKGRGFHFPPC++L+ CG R+LLDC Sbjct: 1 MKFTCLSKGRGFHFPPCHMLNFCGIRILLDC 31 >ref|XP_004515567.1| PREDICTED: integrator complex subunit 9-like [Cicer arietinum] Length = 679 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKGRGFHFPPC++L+ CG R+LLDC Sbjct: 1 MKFTCLSKGRGFHFPPCHMLNFCGIRILLDC 31 >ref|XP_004512875.1| PREDICTED: integrator complex subunit 9-like [Cicer arietinum] Length = 679 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKGRGFHFPPC++L+ CG R+LLDC Sbjct: 1 MKFTCLSKGRGFHFPPCHMLNFCGIRILLDC 31 >ref|XP_006347623.1| PREDICTED: integrator complex subunit 9-like [Solanum tuberosum] Length = 696 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/31 (77%), Positives = 31/31 (100%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLS+GRG++FPPC+I++ICGF+VLLDC Sbjct: 1 MKFTCLSEGRGYYFPPCHIVNICGFQVLLDC 31 >ref|XP_006591184.1| PREDICTED: integrator complex subunit 9-like isoform X12 [Glycine max] Length = 671 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKG GFHFPPC++L+ CG R+LLDC Sbjct: 1 MKFTCLSKGGGFHFPPCHMLNFCGIRILLDC 31 >ref|XP_006591173.1| PREDICTED: integrator complex subunit 9-like isoform X1 [Glycine max] gi|571489287|ref|XP_006591174.1| PREDICTED: integrator complex subunit 9-like isoform X2 [Glycine max] gi|571489289|ref|XP_006591175.1| PREDICTED: integrator complex subunit 9-like isoform X3 [Glycine max] gi|571489291|ref|XP_006591176.1| PREDICTED: integrator complex subunit 9-like isoform X4 [Glycine max] gi|571489293|ref|XP_006591177.1| PREDICTED: integrator complex subunit 9-like isoform X5 [Glycine max] gi|571489295|ref|XP_006591178.1| PREDICTED: integrator complex subunit 9-like isoform X6 [Glycine max] gi|571489297|ref|XP_006591179.1| PREDICTED: integrator complex subunit 9-like isoform X7 [Glycine max] gi|571489299|ref|XP_006591180.1| PREDICTED: integrator complex subunit 9-like isoform X8 [Glycine max] gi|571489301|ref|XP_006591181.1| PREDICTED: integrator complex subunit 9-like isoform X9 [Glycine max] gi|571489303|ref|XP_006591182.1| PREDICTED: integrator complex subunit 9-like isoform X10 [Glycine max] gi|571489305|ref|XP_006591183.1| PREDICTED: integrator complex subunit 9-like isoform X11 [Glycine max] Length = 700 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKG GFHFPPC++L+ CG R+LLDC Sbjct: 1 MKFTCLSKGGGFHFPPCHMLNFCGIRILLDC 31 >ref|XP_007220221.1| hypothetical protein PRUPE_ppa002193mg [Prunus persica] gi|462416683|gb|EMJ21420.1| hypothetical protein PRUPE_ppa002193mg [Prunus persica] Length = 703 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKF+CLSKG G+HFPPC+IL+ICGF +LLDC Sbjct: 1 MKFSCLSKGGGYHFPPCHILNICGFSILLDC 31 >ref|XP_004235291.1| PREDICTED: integrator complex subunit 9 homolog [Solanum lycopersicum] Length = 693 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MK TCLS+GRG++FPPC+I++ICGFRVLLDC Sbjct: 1 MKLTCLSEGRGYYFPPCHIVNICGFRVLLDC 31 >ref|XP_006407828.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] gi|557108974|gb|ESQ49281.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] Length = 698 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MK TCLSKG GFH+PPC++L++CGFR+L+DC Sbjct: 1 MKLTCLSKGDGFHYPPCHMLNLCGFRILIDC 31 >ref|XP_006407827.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] gi|567201907|ref|XP_006407829.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] gi|557108973|gb|ESQ49280.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] gi|557108975|gb|ESQ49282.1| hypothetical protein EUTSA_v10020176mg [Eutrema salsugineum] Length = 699 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MK TCLSKG GFH+PPC++L++CGFR+L+DC Sbjct: 1 MKLTCLSKGDGFHYPPCHMLNLCGFRILIDC 31 >ref|XP_003598666.1| Integrator complex subunit [Medicago truncatula] gi|355487714|gb|AES68917.1| Integrator complex subunit [Medicago truncatula] Length = 268 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 98 SMKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 +MK TCLSKGRGFHFPPC++L+ CG R+L DC Sbjct: 93 TMKLTCLSKGRGFHFPPCHMLNFCGVRILFDC 124 >ref|XP_002882534.1| hypothetical protein ARALYDRAFT_896920 [Arabidopsis lyrata subsp. lyrata] gi|297328374|gb|EFH58793.1| hypothetical protein ARALYDRAFT_896920 [Arabidopsis lyrata subsp. lyrata] Length = 699 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MK TCLSKG GFH+PPC++L++CGFR+L+DC Sbjct: 1 MKLTCLSKGDGFHYPPCHMLNLCGFRILIDC 31 >ref|XP_006385160.1| hypothetical protein POPTR_0004s24410g [Populus trichocarpa] gi|550341928|gb|ERP62957.1| hypothetical protein POPTR_0004s24410g [Populus trichocarpa] Length = 699 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 92 KFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 K TCLSKG GFHFPPC+ILD+ GFR+LLDC Sbjct: 7 KHTCLSKGSGFHFPPCHILDVSGFRILLDC 36 >ref|XP_002520390.1| conserved hypothetical protein [Ricinus communis] gi|223540437|gb|EEF42006.1| conserved hypothetical protein [Ricinus communis] Length = 705 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MKFTCLSKG GFHFPPC ILD+ G+R+L DC Sbjct: 1 MKFTCLSKGNGFHFPPCCILDMSGYRILFDC 31 >gb|EYU45766.1| hypothetical protein MIMGU_mgv1a002829mg [Mimulus guttatus] Length = 633 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 M+FTCLS+G+GF++PPC+ILDI GFR+LLDC Sbjct: 1 MEFTCLSEGKGFYYPPCHILDISGFRILLDC 31 >ref|NP_187409.2| uncharacterized protein [Arabidopsis thaliana] gi|332641036|gb|AEE74557.1| uncharacterized protein AT3G07530 [Arabidopsis thaliana] Length = 699 Score = 59.7 bits (143), Expect = 4e-07 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 M+ TCLSKG GFH+PPC++L++CGFR+L+DC Sbjct: 1 MELTCLSKGDGFHYPPCHMLNLCGFRILIDC 31 >gb|EPS67339.1| hypothetical protein M569_07435 [Genlisea aurea] Length = 411 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 M+FTCLS G G +FPPC+ILDICG RVLLDC Sbjct: 35 MEFTCLSHGNGLYFPPCHILDICGVRVLLDC 65 >ref|XP_002265081.2| PREDICTED: integrator complex subunit 9 homolog [Vitis vinifera] gi|296081277|emb|CBI17721.3| unnamed protein product [Vitis vinifera] Length = 774 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -2 Query: 110 IPLLSMKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 +P + MKFTCLSKG F+FPPC+I+ + GFR+LLDC Sbjct: 77 LPSVYMKFTCLSKGGNFYFPPCHIITVSGFRILLDC 112 >ref|XP_006297090.1| hypothetical protein CARUB_v10013093mg [Capsella rubella] gi|482565799|gb|EOA29988.1| hypothetical protein CARUB_v10013093mg [Capsella rubella] Length = 701 Score = 58.9 bits (141), Expect = 7e-07 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 95 MKFTCLSKGRGFHFPPCYILDICGFRVLLDC 3 MK TCLSKG GF++PPC++L++CGFR+L+DC Sbjct: 1 MKLTCLSKGDGFYYPPCHMLNLCGFRILIDC 31