BLASTX nr result
ID: Paeonia25_contig00052484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00052484 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238030.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002283668.2| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 emb|CBI19307.3| unnamed protein product [Vitis vinifera] 86 5e-15 ref|XP_006364980.1| PREDICTED: pentatricopeptide repeat-containi... 86 7e-15 ref|XP_004287415.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_007225109.1| hypothetical protein PRUPE_ppa002728mg [Prun... 82 8e-14 ref|XP_006472401.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_003615371.1| Pentatricopeptide repeat-containing protein ... 80 2e-13 gb|EXC01172.1| hypothetical protein L484_025549 [Morus notabilis] 78 1e-12 ref|XP_003518275.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_007018313.1| Tetratricopeptide repeat-like superfamily pr... 77 2e-12 ref|XP_006433760.1| hypothetical protein CICLE_v10000550mg [Citr... 77 3e-12 ref|XP_003562575.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_003544256.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_004982698.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_004168621.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_004148433.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_006662937.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_007141301.1| hypothetical protein PHAVU_008G184300g [Phas... 75 1e-11 gb|AFW60783.1| hypothetical protein ZEAMMB73_487264 [Zea mays] 75 1e-11 >ref|XP_004238030.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Solanum lycopersicum] Length = 755 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 VIK+I MCRD H+F+KF+S LT R+IIIRDS+RLHKFVNGHCSCGDF +L+ Sbjct: 705 VIKSISMCRDCHSFMKFISQLTSRKIIIRDSKRLHKFVNGHCSCGDFGSLV 755 >ref|XP_002283668.2| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 762 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V K+I MCRD HNFI+ +S L+ REIIIRDS+RLHKF+NGHCSCGDF TL+ Sbjct: 712 VTKSISMCRDCHNFIRIISLLSAREIIIRDSKRLHKFINGHCSCGDFGTLI 762 >emb|CBI19307.3| unnamed protein product [Vitis vinifera] Length = 683 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V K+I MCRD HNFI+ +S L+ REIIIRDS+RLHKF+NGHCSCGDF TL+ Sbjct: 633 VTKSISMCRDCHNFIRIISLLSAREIIIRDSKRLHKFINGHCSCGDFGTLI 683 >ref|XP_006364980.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Solanum tuberosum] Length = 755 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 VIK+I MCRD H+F+KF+S LT R+IIIRDS+RLHKFV+GHCSCGDF +L+ Sbjct: 705 VIKSISMCRDCHSFMKFISQLTSRKIIIRDSKRLHKFVDGHCSCGDFGSLV 755 >ref|XP_004287415.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Fragaria vesca subsp. vesca] Length = 765 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 VIKNI MCRD H+F+KFVS LT REI IRDS+RLHKF+NG CSCGDF LL Sbjct: 715 VIKNISMCRDCHSFVKFVSLLTSREISIRDSKRLHKFLNGKCSCGDFGALL 765 >ref|XP_007225109.1| hypothetical protein PRUPE_ppa002728mg [Prunus persica] gi|462422045|gb|EMJ26308.1| hypothetical protein PRUPE_ppa002728mg [Prunus persica] Length = 639 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDF 143 V+K++ MCRD HNF+KF+S+LT REI+IRDS+RLHKFVNG CSCGDF Sbjct: 589 VVKSLIMCRDCHNFVKFLSTLTGREIVIRDSKRLHKFVNGTCSCGDF 635 >ref|XP_006472401.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Citrus sinensis] Length = 758 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDF 143 VIK+ MCRD HNFIK ++SLT REII+RDS+RLHKFVNGHC+C DF Sbjct: 708 VIKSTTMCRDCHNFIKIITSLTAREIIVRDSKRLHKFVNGHCTCRDF 754 >ref|XP_003615371.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355516706|gb|AES98329.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 765 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V+KN MCRDSHNF+K++S+LT REII++DS+RLHKFVNG CSCG+ L Sbjct: 715 VVKNTLMCRDSHNFVKYISTLTSREIIVKDSKRLHKFVNGQCSCGNIGGFL 765 >gb|EXC01172.1| hypothetical protein L484_025549 [Morus notabilis] Length = 763 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 VIKN MCRD HNF+K +S LT REI IRDS+RLHK VNG CSCGDF L+ Sbjct: 713 VIKNFIMCRDCHNFMKSISLLTAREITIRDSKRLHKIVNGKCSCGDFGILI 763 >ref|XP_003518275.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Length = 754 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V+K+ +CRDSHNFIK VS+LT REII++DS+RLHKFVNG CSCG+F L Sbjct: 704 VVKSTLICRDSHNFIKCVSTLTGREIIVKDSKRLHKFVNGECSCGNFGGFL 754 >ref|XP_007018313.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508723641|gb|EOY15538.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 763 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 +IKNI MCR HNF+K +SSL R+II+RD +RLHKFVNG CSCGD+ LL Sbjct: 713 LIKNISMCRGCHNFMKAISSLNARKIIVRDRKRLHKFVNGQCSCGDYGGLL 763 >ref|XP_006433760.1| hypothetical protein CICLE_v10000550mg [Citrus clementina] gi|557535882|gb|ESR47000.1| hypothetical protein CICLE_v10000550mg [Citrus clementina] Length = 647 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDF 143 V+K+ +CRD HNFIK ++ LT REII+RDS+RLHKFVNGHC+C DF Sbjct: 597 VVKSTTVCRDCHNFIKIITLLTAREIIVRDSKRLHKFVNGHCTCRDF 643 >ref|XP_003562575.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Brachypodium distachyon] Length = 770 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 + KNI MCRD H+ IKF S L REI++RDS+RLHKF +G CSCGDF TLL Sbjct: 720 ITKNITMCRDCHSSIKFFSLLANREIVVRDSKRLHKFKDGRCSCGDFGTLL 770 >ref|XP_003544256.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Glycine max] Length = 758 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V+K+ +CRDSHNFIK+VS+L REII++DS+RLHKF NG CSCG+F L Sbjct: 708 VVKSTLICRDSHNFIKYVSTLAGREIIVKDSKRLHKFANGECSCGNFGGFL 758 >ref|XP_004982698.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like isoform X1 [Setaria italica] Length = 772 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V KNI MCRD H+ IKF S L REI++RDS+RLHKF +G CSCGDF LL Sbjct: 722 VTKNITMCRDCHSSIKFFSLLANREIVVRDSKRLHKFKDGQCSCGDFSALL 772 >ref|XP_004168621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 755 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDF 143 V+K+I MCRD HNFI+F+S L REI+IRDS++LHKF+NG+CSCG + Sbjct: 705 VVKSITMCRDCHNFIRFISLLKGREIVIRDSKQLHKFLNGYCSCGGY 751 >ref|XP_004148433.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 749 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDF 143 V+K+I MCRD HNFI+F+S L REI+IRDS++LHKF+NG+CSCG + Sbjct: 699 VVKSITMCRDCHNFIRFISLLKGREIVIRDSKQLHKFLNGYCSCGGY 745 >ref|XP_006662937.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Oryza brachyantha] Length = 768 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V KNI MCRD H+ IKF S L REI++RDS+RLHKF +G CSCGDF LL Sbjct: 718 VTKNITMCRDCHSSIKFFSLLANREIVVRDSKRLHKFKDGRCSCGDFGALL 768 >ref|XP_007141301.1| hypothetical protein PHAVU_008G184300g [Phaseolus vulgaris] gi|561014434|gb|ESW13295.1| hypothetical protein PHAVU_008G184300g [Phaseolus vulgaris] Length = 754 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V+K+ +C DSHNFIK+VS+L+ REII+RDS+RLHKFVNG CSCG+ LL Sbjct: 704 VVKSTLLCTDSHNFIKYVSTLSGREIIVRDSKRLHKFVNGKCSCGNSYGLL 754 >gb|AFW60783.1| hypothetical protein ZEAMMB73_487264 [Zea mays] Length = 770 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 3 VIKNIGMCRDSHNFIKFVSSLTYREIIIRDSRRLHKFVNGHCSCGDFDTLL 155 V KNI MCRD H+ IKF S L REI++RDS+RLHKF +G CSCGDF LL Sbjct: 720 VTKNITMCRDCHSSIKFFSLLANREIVVRDSKRLHKFKDGRCSCGDFGALL 770