BLASTX nr result
ID: Paeonia25_contig00052329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00052329 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001878109.1| polysaccharide lyase family 14 protein [Lacc... 57 4e-06 ref|XP_002471111.1| predicted protein [Postia placenta Mad-698-R... 56 6e-06 >ref|XP_001878109.1| polysaccharide lyase family 14 protein [Laccaria bicolor S238N-H82] gi|164646563|gb|EDR10808.1| polysaccharide lyase family 14 protein [Laccaria bicolor S238N-H82] Length = 439 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 103 WDNSSSVLQVFYPADSINPSNSPLGGAEFYATPL 2 WDN++SVLQ +YPA+SINP+ P GGA+FYA PL Sbjct: 134 WDNTTSVLQAYYPANSINPAQFPQGGAQFYAAPL 167 >ref|XP_002471111.1| predicted protein [Postia placenta Mad-698-R] gi|220729800|gb|EED83668.1| predicted protein [Postia placenta Mad-698-R] Length = 1042 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 97 NSSSVLQVFYPADSINPSNSPLGGAEFYATPL 2 NS++V+Q+FYPA+SINP+N P GGA+FYATPL Sbjct: 660 NSTAVMQLFYPANSINPANEPQGGADFYATPL 691