BLASTX nr result
ID: Paeonia25_contig00052257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00052257 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002469563.1| predicted protein [Postia placenta Mad-698-R... 95 1e-17 gb|EMD41920.1| hypothetical protein CERSUDRAFT_110478 [Ceriporio... 92 6e-17 gb|EPT01504.1| hypothetical protein FOMPIDRAFT_1029743 [Fomitops... 90 4e-16 emb|CCM03128.1| predicted protein [Fibroporia radiculosa] 84 2e-14 ref|XP_001829165.2| hypothetical protein CC1G_01845 [Coprinopsis... 77 3e-12 gb|EGN93128.1| hypothetical protein SERLA73DRAFT_78970 [Serpula ... 74 2e-11 gb|AEN14437.1| conserved hypothetical protein [Lentinula edodes] 72 8e-11 gb|ESK90899.1| f-box domain-containing protein [Moniliophthora r... 65 1e-08 ref|XP_007390741.1| hypothetical protein PHACADRAFT_82095, parti... 64 3e-08 gb|EIW87019.1| YccV-like-domain-containing protein [Coniophora p... 62 6e-08 ref|XP_007360355.1| hypothetical protein DICSQDRAFT_95721 [Dicho... 60 3e-07 >ref|XP_002469563.1| predicted protein [Postia placenta Mad-698-R] gi|220731367|gb|EED85212.1| predicted protein [Postia placenta Mad-698-R] Length = 612 Score = 94.7 bits (234), Expect = 1e-17 Identities = 42/76 (55%), Positives = 52/76 (68%) Frame = -2 Query: 230 WPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTH 51 WPWLP+E++THILSFLPA+R D + TLV+ NS LRAA P +W HYR RYT Sbjct: 6 WPWLPVELHTHILSFLPATRDRADLSVKTLVSYSRANSYLRAAACQPGLWMRHYRARYTD 65 Query: 50 CVEELEDERRQAANGN 3 C+ E E +RR+ A GN Sbjct: 66 CIAEREAQRREVAAGN 81 >gb|EMD41920.1| hypothetical protein CERSUDRAFT_110478 [Ceriporiopsis subvermispora B] Length = 620 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/77 (55%), Positives = 53/77 (68%) Frame = -2 Query: 233 SWPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYT 54 +WPWLP+E+Y HIL+ LP S D TLV+CLS NS+LR+A LT ++WEP YR RYT Sbjct: 15 TWPWLPVELYVHILTSLPPS----DAGLTTLVSCLSANSVLRSAALTSSLWEPFYRARYT 70 Query: 53 HCVEELEDERRQAANGN 3 CVEE E E R G+ Sbjct: 71 ECVEEREAELRATYGGD 87 >gb|EPT01504.1| hypothetical protein FOMPIDRAFT_1029743 [Fomitopsis pinicola FP-58527 SS1] Length = 628 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/80 (50%), Positives = 50/80 (62%) Frame = -2 Query: 242 MEGSWPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRV 63 M G WPWLP E+Y IL FLP D + TL+ CL +S LR A ++W+PHYR+ Sbjct: 1 MYGRWPWLPTELYADILGFLPPDDDYTDASVKTLLNCLGGSSQLRQAAKQSSVWKPHYRL 60 Query: 62 RYTHCVEELEDERRQAANGN 3 RYT CVEE E ERR+ G+ Sbjct: 61 RYTDCVEEKEAERREKFRGD 80 >emb|CCM03128.1| predicted protein [Fibroporia radiculosa] Length = 635 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/79 (50%), Positives = 46/79 (58%) Frame = -2 Query: 239 EGSWPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVR 60 E W LP E+Y HILSF P +R D + TL +CL TN LRA L P +WEPHYR R Sbjct: 9 EPPWSRLPTELYAHILSFFPPARDHADSSAKTLASCLCTNRHLRAVALHPGLWEPHYRAR 68 Query: 59 YTHCVEELEDERRQAANGN 3 YT VEE E R G+ Sbjct: 69 YTERVEENEARRAAETGGD 87 >ref|XP_001829165.2| hypothetical protein CC1G_01845 [Coprinopsis cinerea okayama7#130] gi|298411570|gb|EAU92800.2| hypothetical protein CC1G_01845 [Coprinopsis cinerea okayama7#130] Length = 626 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/71 (50%), Positives = 46/71 (64%) Frame = -2 Query: 233 SWPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYT 54 S P LP++I +IL LP RS P+ TLV+CL+TN L R A ++WEPHYRVRY Sbjct: 2 SLPHLPLDIIVNILRSLPIERSCHSPSVATLVSCLATNQLFREAASLSSLWEPHYRVRYR 61 Query: 53 HCVEELEDERR 21 H EE + ER+ Sbjct: 62 HSDEEKDRERK 72 >gb|EGN93128.1| hypothetical protein SERLA73DRAFT_78970 [Serpula lacrymans var. lacrymans S7.3] Length = 572 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/80 (47%), Positives = 47/80 (58%) Frame = -2 Query: 242 MEGSWPWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRV 63 M + LP +IY HIL P S +D + TL ACL TNS LR A +WEPHY+ Sbjct: 1 MTSGFRLLPFDIYLHILVKFPVSDHSDD-SVKTLSACLRTNSTLREAASLSKVWEPHYKA 59 Query: 62 RYTHCVEELEDERRQAANGN 3 RYT CV E+ R+QAA G+ Sbjct: 60 RYTECVTAEEELRKQAAGGD 79 >gb|AEN14437.1| conserved hypothetical protein [Lentinula edodes] Length = 622 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/75 (45%), Positives = 46/75 (61%) Frame = -2 Query: 227 PWLPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTHC 48 P LP+++ HIL +P SR + D + TLV C TN+L R A PA+W+ HY+VRY H Sbjct: 3 PSLPLDVLVHILYQIPPSRDL-DSSVRTLVQCSLTNTLFREAAAIPALWQQHYQVRYLHA 61 Query: 47 VEELEDERRQAANGN 3 E E +R+ NGN Sbjct: 62 NEASEGQRKAETNGN 76 >gb|ESK90899.1| f-box domain-containing protein [Moniliophthora roreri MCA 2997] Length = 602 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = -2 Query: 227 PWLPIEIYTHILSFLPASRSVE-DPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTH 51 P LP++ HILS L ASR E + + T C TNSL R A +WEPHY+VRY Sbjct: 7 PQLPLDCLIHILSQLSASRDAEGESSIRTFANCSLTNSLFRQAATISRLWEPHYKVRYRQ 66 Query: 50 CVEELEDERRQAANGN 3 C E E++R+ N Sbjct: 67 CNVENEEQRKDKLQEN 82 >ref|XP_007390741.1| hypothetical protein PHACADRAFT_82095, partial [Phanerochaete carnosa HHB-10118-sp] gi|409051841|gb|EKM61317.1| hypothetical protein PHACADRAFT_82095, partial [Phanerochaete carnosa HHB-10118-sp] Length = 598 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = -2 Query: 197 ILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTHCVEELEDERR 21 ILS +PAS+ EDP+ TL+ CL NS+LRAA L P +W+ Y VRYTH E+ E +RR Sbjct: 1 ILSEIPASK--EDPSEQTLLYCLRANSVLRAAALAPQVWKTPYLVRYTHSDEDRERQRR 57 >gb|EIW87019.1| YccV-like-domain-containing protein [Coniophora puteana RWD-64-598 SS2] Length = 627 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/73 (43%), Positives = 41/73 (56%) Frame = -2 Query: 221 LPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTHCVE 42 LP +I H+L LP S S + P TL ACL NSLLR A +WE HY+ RY C Sbjct: 4 LPFDICLHVLRHLPVSESPDGP--RTLAACLQANSLLREAASQSFLWEAHYKARYKLCNP 61 Query: 41 ELEDERRQAANGN 3 + E R Q ++G+ Sbjct: 62 DKEAARLQQSHGD 74 >ref|XP_007360355.1| hypothetical protein DICSQDRAFT_95721 [Dichomitus squalens LYAD-421 SS1] gi|395334497|gb|EJF66873.1| hypothetical protein DICSQDRAFT_95721 [Dichomitus squalens LYAD-421 SS1] Length = 599 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/73 (45%), Positives = 42/73 (57%) Frame = -2 Query: 221 LPIEIYTHILSFLPASRSVEDPTTNTLVACLSTNSLLRAATLTPAIWEPHYRVRYTHCVE 42 LP+E+YTH L LP E + T+V+ LS NS+ RAA L +IW Y RY H + Sbjct: 5 LPVELYTHCLLQLPPQ---EPSSLKTVVSFLSANSVARAAALDRSIWARLYLARYIHNIP 61 Query: 41 ELEDERRQAANGN 3 E EDERR G+ Sbjct: 62 EHEDERRARLGGD 74