BLASTX nr result
ID: Paeonia25_contig00051894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00051894 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007398496.1| hypothetical protein PHACADRAFT_260358 [Phan... 71 1e-10 >ref|XP_007398496.1| hypothetical protein PHACADRAFT_260358 [Phanerochaete carnosa HHB-10118-sp] gi|409044337|gb|EKM53819.1| hypothetical protein PHACADRAFT_260358 [Phanerochaete carnosa HHB-10118-sp] Length = 441 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +1 Query: 184 MQSYEETVQPRDRRPWTDEEDEKLRAAIEEEDPDASPPSRWHAIAQ 321 M +++ VQPRDRR WT++EDE LR AIE+ED DA+PPS+WHAIA+ Sbjct: 1 MYRHDDAVQPRDRRAWTEDEDELLRQAIEKEDGDANPPSKWHAIAK 46