BLASTX nr result
ID: Paeonia25_contig00049433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049433 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007369408.1| hypothetical protein DICSQDRAFT_139953 [Dich... 59 9e-07 gb|EIW59742.1| hypothetical protein TRAVEDRAFT_28759 [Trametes v... 58 1e-06 >ref|XP_007369408.1| hypothetical protein DICSQDRAFT_139953 [Dichomitus squalens LYAD-421 SS1] gi|395325489|gb|EJF57911.1| hypothetical protein DICSQDRAFT_139953 [Dichomitus squalens LYAD-421 SS1] Length = 80 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 1 DPRCIKLYGPDVERDIDTVEDSKCFQCRAAAARKPPS 111 DP CIK +GPD+++D+DTV+D CFQCRAAAARK P+ Sbjct: 45 DPGCIKNFGPDIQKDVDTVKDD-CFQCRAAAARKVPA 80 >gb|EIW59742.1| hypothetical protein TRAVEDRAFT_28759 [Trametes versicolor FP-101664 SS1] Length = 81 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 DPRCIKLYGPDVERDIDTVEDSKCFQCRAAAARKPP 108 DP CIK +GPDV++DIDTV+D +CFQCRAAAAR+ P Sbjct: 45 DPTCIKNFGPDVQKDIDTVKD-ECFQCRAAAARRLP 79