BLASTX nr result
ID: Paeonia25_contig00049282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00049282 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82565.1| hypothetical protein VITISV_033674 [Vitis vinifera] 48 2e-06 >emb|CAN82565.1| hypothetical protein VITISV_033674 [Vitis vinifera] Length = 710 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 103 PKVPSFWDPVMEMISGRLEGWKISSLSKGGRLVL 2 PK FWDPV+E IS RL+GWK + LS GGR+ L Sbjct: 89 PKTIGFWDPVVERISRRLDGWKKAFLSLGGRITL 122 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 201 QSAVVEGRQTVDAILTANETVD 136 Q A VEGR +D +L ANE VD Sbjct: 47 QGAFVEGRHILDVVLIANEVVD 68