BLASTX nr result
ID: Paeonia25_contig00047441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047441 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 75 1e-11 ref|XP_007013742.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 ref|XP_007013741.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 ref|XP_002516609.1| pentatricopeptide repeat-containing protein,... 62 8e-08 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 4/75 (5%) Frame = +2 Query: 2 ACKRGNSSMVHRIWCIMEYEVLELMVVSFTCLIQYWFKVGKILKGLQLFQFMMHDDPIPN 181 ACK+GNSSM+ R+ MEYE ++L VVS TCLIQY+ +GKI + L+L + M+ + P Sbjct: 370 ACKQGNSSMIRRVLYRMEYEGVKLNVVSSTCLIQYFCAIGKISECLELLESMIRNGLNPT 429 Query: 182 IVTFNV----ICKNG 214 +VTFN+ +CKNG Sbjct: 430 VVTFNMLLDKLCKNG 444 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/75 (50%), Positives = 53/75 (70%), Gaps = 4/75 (5%) Frame = +2 Query: 2 ACKRGNSSMVHRIWCIMEYEVLELMVVSFTCLIQYWFKVGKILKGLQLFQFMMHDDPIPN 181 ACK+GNSSM+ R+ MEYE ++L VVS TCLIQY+ +GKI + L+L + M+ + P Sbjct: 478 ACKQGNSSMIRRVLYRMEYEGVKLNVVSSTCLIQYFCAIGKISECLELLESMIRNGLNPT 537 Query: 182 IVTFNV----ICKNG 214 +VTFN+ +CKNG Sbjct: 538 VVTFNMLLDKLCKNG 552 >ref|XP_007013742.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] gi|508784105|gb|EOY31361.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] Length = 720 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/74 (44%), Positives = 50/74 (67%), Gaps = 4/74 (5%) Frame = +2 Query: 2 ACKRGNSSMVHRIWCIMEYEVLELMVVSFTCLIQYWFKVGKILKGLQLFQFMMHDDPIPN 181 AC+ GNS+++ I C MEYE ++L V S TCLIQY+ +GK + L+L + +MH+DP Sbjct: 479 ACRLGNSAIIQSILCRMEYEHIKLDVFSLTCLIQYFCTIGKFSECLKLLESIMHNDPSSI 538 Query: 182 IVTFNV----ICKN 211 ++ FN+ +CKN Sbjct: 539 VIPFNILLHNLCKN 552 >ref|XP_007013741.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508784104|gb|EOY31360.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 761 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/74 (44%), Positives = 50/74 (67%), Gaps = 4/74 (5%) Frame = +2 Query: 2 ACKRGNSSMVHRIWCIMEYEVLELMVVSFTCLIQYWFKVGKILKGLQLFQFMMHDDPIPN 181 AC+ GNS+++ I C MEYE ++L V S TCLIQY+ +GK + L+L + +MH+DP Sbjct: 479 ACRLGNSAIIQSILCRMEYEHIKLDVFSLTCLIQYFCTIGKFSECLKLLESIMHNDPSSI 538 Query: 182 IVTFNV----ICKN 211 ++ FN+ +CKN Sbjct: 539 VIPFNILLHNLCKN 552 >ref|XP_002516609.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544429|gb|EEF45950.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 463 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Frame = +2 Query: 2 ACKRGNSSMVHRIWCIMEYEVLELMVVSFTCLIQYWFKVGKILKGLQLFQFMMHDDPIPN 181 ACK+GNS M+ +I MEYE ++ +VS T LIQY +VGK + L+L MMH+ P Sbjct: 369 ACKQGNSVMIQKILHRMEYEGIKPDIVSSTFLIQYLCRVGKFSECLKLLDAMMHNGTGPT 428 Query: 182 IVTFNVI----CKNG 214 +T N++ CKNG Sbjct: 429 KITINMVLNKLCKNG 443