BLASTX nr result
ID: Paeonia25_contig00047388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047388 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384260.1| hypothetical protein POPTR_0004s11150g [Popu... 58 2e-06 >ref|XP_006384260.1| hypothetical protein POPTR_0004s11150g [Populus trichocarpa] gi|550340806|gb|ERP62057.1| hypothetical protein POPTR_0004s11150g [Populus trichocarpa] Length = 220 Score = 57.8 bits (138), Expect = 2e-06 Identities = 47/139 (33%), Positives = 70/139 (50%), Gaps = 21/139 (15%) Frame = +1 Query: 82 ATAQKMGLGGRKMVVDKVWRKEAEKE--ISPISGKDNSASKMSFGRLQNQLSDENKNMLE 255 A+ +KMGLGGRKM V K R+E EKE + + +DNS + S + Q+ + N + Sbjct: 61 ASTRKMGLGGRKMAVQKESRRETEKEQGLHGQASEDNSGANYSNVKCDFQVKGSDFNQKD 120 Query: 256 AMALD----SVSLGMSKSEPQAHDLPKTSSIHTQNYKAVSTEIRFESSQ----------- 390 L+ S LG +++ H LPK++S ++ KA+ T+ ES Sbjct: 121 MSNLERETLSARLGTPRTDQTVH-LPKSNS---KDSKALPTKTSLESPSRADIDQEPQGS 176 Query: 391 ----KEEAQRLLEATNEIV 435 K E QRLL+AT E+V Sbjct: 177 ATDLKSEMQRLLDATREMV 195