BLASTX nr result
ID: Paeonia25_contig00047275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047275 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS93445.1| hypothetical protein FOMPIDRAFT_1136150 [Fomitops... 85 1e-14 gb|ETW79115.1| hypothetical protein HETIRDRAFT_323345 [Heterobas... 82 8e-14 emb|CCM05228.1| predicted protein [Fibroporia radiculosa] 82 8e-14 gb|EIW78085.1| hypothetical protein CONPUDRAFT_129128 [Coniophor... 82 1e-13 ref|XP_007320485.1| hypothetical protein SERLADRAFT_362469 [Serp... 79 7e-13 gb|EIW52186.1| hypothetical protein TRAVEDRAFT_40598 [Trametes v... 74 2e-11 ref|XP_006456157.1| hypothetical protein AGABI2DRAFT_210964 [Aga... 70 2e-10 ref|XP_007331585.1| hypothetical protein AGABI1DRAFT_115004 [Aga... 70 3e-10 ref|XP_007304372.1| hypothetical protein STEHIDRAFT_147235 [Ster... 66 6e-09 gb|EGN97651.1| hypothetical protein SERLA73DRAFT_57380 [Serpula ... 65 8e-09 gb|EMD36117.1| hypothetical protein CERSUDRAFT_156889 [Ceriporio... 63 4e-08 gb|EPS93444.1| hypothetical protein FOMPIDRAFT_1136145 [Fomitops... 62 6e-08 ref|XP_001885834.1| predicted protein [Laccaria bicolor S238N-H8... 59 7e-07 ref|XP_001838136.1| hypothetical protein CC1G_05617 [Coprinopsis... 58 1e-06 gb|EIW52189.1| hypothetical protein TRAVEDRAFT_135657 [Trametes ... 58 2e-06 ref|XP_007365211.1| hypothetical protein DICSQDRAFT_58994 [Dicho... 57 2e-06 ref|XP_002471880.1| predicted protein [Postia placenta Mad-698-R... 57 3e-06 ref|XP_007309720.1| hypothetical protein STEHIDRAFT_172087 [Ster... 56 6e-06 ref|XP_007400033.1| hypothetical protein PHACADRAFT_151262 [Phan... 55 8e-06 >gb|EPS93445.1| hypothetical protein FOMPIDRAFT_1136150 [Fomitopsis pinicola FP-58527 SS1] Length = 572 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/64 (59%), Positives = 49/64 (76%) Frame = -2 Query: 194 ITYQSTTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQL 15 + Y++TT RVL+I EI+ELI SF D++ I NACVCKRW IALD +WR V+D+ L +L Sbjct: 1 MAYETTTQRVLDIPEIIELIMSFLDKRDNIQNACVCKRWCEIALDCVWRSVEDITQLLRL 60 Query: 14 LAPL 3 LAPL Sbjct: 61 LAPL 64 >gb|ETW79115.1| hypothetical protein HETIRDRAFT_323345 [Heterobasidion irregulare TC 32-1] Length = 567 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/62 (58%), Positives = 49/62 (79%) Frame = -2 Query: 188 YQSTTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLA 9 +++ HRVL I E+L++IF+F DRQ+ INN+ VCK+W+ IALD +WR VD+L LF LLA Sbjct: 3 FEAAVHRVLAIPELLDIIFTFQDRQSNINNSLVCKQWTGIALDNIWREVDNLPHLFHLLA 62 Query: 8 PL 3 PL Sbjct: 63 PL 64 >emb|CCM05228.1| predicted protein [Fibroporia radiculosa] Length = 582 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/70 (60%), Positives = 48/70 (68%) Frame = -2 Query: 212 MASHSIITYQSTTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDL 33 MAS + Y ST +RVLEI EI+ELI F D NA VCKRWS I LD+LWR+VD+L Sbjct: 1 MASIPPLGYASTVNRVLEIPEIIELILEFLDLGDNARNALVCKRWSEICLDLLWRKVDNL 60 Query: 32 RLLFQLLAPL 3 LF LLAPL Sbjct: 61 PRLFSLLAPL 70 >gb|EIW78085.1| hypothetical protein CONPUDRAFT_129128 [Coniophora puteana RWD-64-598 SS2] Length = 481 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = -2 Query: 188 YQSTTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLA 9 ++ +HRVL + E+LE IFS+ DR+ +NNACVCK+WS+I LDMLWR VD++ LF L Sbjct: 19 FRPASHRVLFVPELLEFIFSYLDREDNVNNACVCKQWSTIGLDMLWRNVDNIFQLFNALC 78 Query: 8 PL 3 P+ Sbjct: 79 PI 80 >ref|XP_007320485.1| hypothetical protein SERLADRAFT_362469 [Serpula lacrymans var. lacrymans S7.9] gi|336382094|gb|EGO23245.1| hypothetical protein SERLADRAFT_362469 [Serpula lacrymans var. lacrymans S7.9] Length = 564 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/60 (55%), Positives = 46/60 (76%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 ST HR+L I E++ ++F+F DR++ + NACVCK WS IALD+LW+ VD+L L LLAP+ Sbjct: 9 STAHRMLFIPELVNMVFTFMDRESNVTNACVCKHWSDIALDLLWKNVDNLLQLINLLAPV 68 >gb|EIW52186.1| hypothetical protein TRAVEDRAFT_40598 [Trametes versicolor FP-101664 SS1] Length = 593 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/60 (60%), Positives = 42/60 (70%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 +TT RVL I EILEL+F F + Q ACVCK WS +AL LWR VDDL LF+LLAP+ Sbjct: 11 ATTQRVLAIPEILELVFLFLNVQDAAQCACVCKSWSEVALSSLWRDVDDLHRLFKLLAPI 70 >ref|XP_006456157.1| hypothetical protein AGABI2DRAFT_210964 [Agaricus bisporus var. bisporus H97] gi|426193230|gb|EKV43164.1| hypothetical protein AGABI2DRAFT_210964 [Agaricus bisporus var. bisporus H97] Length = 573 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 +T HRVL I E+L+ +F D ++ +NNA V + WS IALD LWR+V+DL LF LLAPL Sbjct: 6 TTMHRVLAIPELLDTVFKSMDSRSNLNNALVSRAWSEIALDTLWRQVNDLYRLFNLLAPL 65 >ref|XP_007331585.1| hypothetical protein AGABI1DRAFT_115004 [Agaricus bisporus var. burnettii JB137-S8] gi|409077358|gb|EKM77724.1| hypothetical protein AGABI1DRAFT_115004 [Agaricus bisporus var. burnettii JB137-S8] Length = 573 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 +T HRVL I E+L+ +F D ++ +NNA V + WS IALD LWR+V+DL LF LLAPL Sbjct: 6 TTMHRVLAIPELLDTVFKSMDGRSNLNNALVSRAWSEIALDTLWRQVNDLYRLFNLLAPL 65 >ref|XP_007304372.1| hypothetical protein STEHIDRAFT_147235 [Stereum hirsutum FP-91666 SS1] gi|389745551|gb|EIM86732.1| hypothetical protein STEHIDRAFT_147235 [Stereum hirsutum FP-91666 SS1] Length = 578 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/64 (50%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = -2 Query: 185 QSTTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVD---DLRLLFQL 15 QS HRVL+I E+L+L+F D ++ +NNACV W+ I L+ LWRRVD + LF Sbjct: 4 QSAAHRVLDIPELLDLVFRLLDHKSNLNNACVSHHWTDIGLNNLWRRVDSAPQIVHLFSK 63 Query: 14 LAPL 3 LAPL Sbjct: 64 LAPL 67 >gb|EGN97651.1| hypothetical protein SERLA73DRAFT_57380 [Serpula lacrymans var. lacrymans S7.3] Length = 542 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = -2 Query: 140 LIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 ++F+F DR++ + NACVCK WS IALD+LW+ VD+L L LLAP+ Sbjct: 1 MVFTFMDRESNVTNACVCKHWSDIALDLLWKNVDNLLQLINLLAPV 46 >gb|EMD36117.1| hypothetical protein CERSUDRAFT_156889 [Ceriporiopsis subvermispora B] Length = 576 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -2 Query: 158 ITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAP 6 I E+LEL+FS D ++ ACVC+ WS IALD+LWR VDDL L LLAP Sbjct: 11 IHELLELVFSQLDDRSLARVACVCRLWSDIALDILWREVDDLHRLISLLAP 61 >gb|EPS93444.1| hypothetical protein FOMPIDRAFT_1136145 [Fomitopsis pinicola FP-58527 SS1] Length = 575 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/59 (45%), Positives = 39/59 (66%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAP 6 S + +++E++ +I SF D ++ +A VCKRW IALD+LWR VDDL LF L+P Sbjct: 4 SAASTLADVSELIAIILSFLDNRSLATSARVCKRWKEIALDLLWREVDDLHRLFTTLSP 62 >ref|XP_001885834.1| predicted protein [Laccaria bicolor S238N-H82] gi|164639105|gb|EDR03378.1| predicted protein [Laccaria bicolor S238N-H82] Length = 615 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -2 Query: 140 LIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 +IF F R++ NA VC+RWS IALD LWR VDD LF LLAPL Sbjct: 1 MIFRFLSRESNAENARVCRRWSDIALDALWRVVDDPPRLFMLLAPL 46 >ref|XP_001838136.1| hypothetical protein CC1G_05617 [Coprinopsis cinerea okayama7#130] gi|116500818|gb|EAU83713.1| hypothetical protein CC1G_05617 [Coprinopsis cinerea okayama7#130] Length = 329 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -2 Query: 182 STTHRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAP 6 S T+RVL++ E+L+ + S D + + A V K WS IAL LWR +DD R LF+LLAP Sbjct: 5 SVTNRVLQVPELLDTVCSHLDNISLVRAARVNKTWSPIALSFLWRELDDPRPLFRLLAP 63 >gb|EIW52189.1| hypothetical protein TRAVEDRAFT_135657 [Trametes versicolor FP-101664 SS1] Length = 595 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -2 Query: 158 ITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 I E+L +IF++ D + ACVCK WS IALD LW V DLR +LAPL Sbjct: 12 IDELLVMIFAYLDDRALSRAACVCKHWSEIALDCLWHEVTDLRRALTVLAPL 63 >ref|XP_007365211.1| hypothetical protein DICSQDRAFT_58994 [Dichomitus squalens LYAD-421 SS1] gi|395329570|gb|EJF61956.1| hypothetical protein DICSQDRAFT_58994 [Dichomitus squalens LYAD-421 SS1] Length = 595 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -2 Query: 158 ITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 I E+L ++FS+ D + ACVCK W+ +ALD LW V+DLR + +LAPL Sbjct: 12 IDELLTMMFSYLDDRDLARAACVCKHWAELALDALWSEVNDLRRVLTVLAPL 63 >ref|XP_002471880.1| predicted protein [Postia placenta Mad-698-R] gi|220729068|gb|EED82949.1| predicted protein [Postia placenta Mad-698-R] Length = 480 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -2 Query: 158 ITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAP 6 I+E+L LI SF D+Q+ A VC+ WS +ALD LWR VDDL L LL P Sbjct: 9 ISELLLLIISFLDQQSLARAARVCRSWSHVALDALWRDVDDLSRLLALLCP 59 >ref|XP_007309720.1| hypothetical protein STEHIDRAFT_172087 [Stereum hirsutum FP-91666 SS1] gi|389739844|gb|EIM81036.1| hypothetical protein STEHIDRAFT_172087 [Stereum hirsutum FP-91666 SS1] Length = 545 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = -2 Query: 173 HRVLEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLA 9 H+ L ++EIL LIF+F R NA VCK WS ALD +W + D+ FQ LA Sbjct: 2 HKALTLSEILNLIFAFLPRSANATNARVCKTWSDSALDDVWYEIPDVSKAFQALA 56 >ref|XP_007400033.1| hypothetical protein PHACADRAFT_151262 [Phanerochaete carnosa HHB-10118-sp] gi|409041380|gb|EKM50865.1| hypothetical protein PHACADRAFT_151262 [Phanerochaete carnosa HHB-10118-sp] Length = 470 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/54 (46%), Positives = 34/54 (62%) Frame = -2 Query: 164 LEITEILELIFSFTDRQTKINNACVCKRWSSIALDMLWRRVDDLRLLFQLLAPL 3 + + E+L L+FS D + A VC++W+ +ALD LW V DLR L LLAPL Sbjct: 11 IHVPELLALVFSHLDNRNLARAARVCRQWADVALDTLWHTVTDLRPLLSLLAPL 64