BLASTX nr result
ID: Paeonia25_contig00047265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047265 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007390316.1| hypothetical protein PHACADRAFT_110678 [Phan... 60 4e-07 gb|EPS99136.1| hypothetical protein FOMPIDRAFT_1124873 [Fomitops... 57 3e-06 gb|ESK98447.1| atp-dependent rna helicase has1 [Moniliophthora r... 57 3e-06 >ref|XP_007390316.1| hypothetical protein PHACADRAFT_110678 [Phanerochaete carnosa HHB-10118-sp] gi|409051397|gb|EKM60873.1| hypothetical protein PHACADRAFT_110678 [Phanerochaete carnosa HHB-10118-sp] Length = 542 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 193 VRRTGKGRREETLGRRAVEKEVYKKGMESKMRKGDKQQWSR 71 VR+ KGRR ETLG+R VEKEVYKKG+E K + D QWSR Sbjct: 502 VRKNSKGRRTETLGKRVVEKEVYKKGLERKKMRADGAQWSR 542 >gb|EPS99136.1| hypothetical protein FOMPIDRAFT_1124873 [Fomitopsis pinicola FP-58527 SS1] Length = 562 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 190 RRTGKGRREETLGRRAVEKEVYKKGMESKMRKGD-KQQWSR 71 RR K RR+ETLGRR VEKEVYKKG+E K KG+ K QWSR Sbjct: 522 RRDNKERRKETLGRRKVEKEVYKKGLERKKLKGEGKAQWSR 562 >gb|ESK98447.1| atp-dependent rna helicase has1 [Moniliophthora roreri MCA 2997] Length = 562 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -1 Query: 196 QVRRTGKGRREETLGRRAVEKEVYKKGMESKMRKGDKQQWSR 71 QVRR GK RR ETLG++ VEKEVYKKG E R D QWSR Sbjct: 521 QVRRQGKQRRIETLGKKRVEKEVYKKGKERNQRGKDGTQWSR 562