BLASTX nr result
ID: Paeonia25_contig00047168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00047168 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT02674.1| hypothetical protein FOMPIDRAFT_1117985 [Fomitops... 58 1e-06 gb|EMD32101.1| hypothetical protein CERSUDRAFT_59129 [Ceriporiop... 58 2e-06 ref|XP_001830490.2| cytoplasmic protein [Coprinopsis cinerea oka... 58 2e-06 ref|XP_007266957.1| cytoplasmic protein [Fomitiporia mediterrane... 57 3e-06 ref|XP_007317234.1| hypothetical protein SERLADRAFT_360974 [Serp... 57 3e-06 gb|ETW80615.1| hypothetical protein HETIRDRAFT_154870 [Heterobas... 56 4e-06 gb|EPQ57371.1| hypothetical protein GLOTRDRAFT_137711 [Gloeophyl... 55 8e-06 ref|XP_007396743.1| hypothetical protein PHACADRAFT_174540 [Phan... 55 8e-06 ref|XP_007369483.1| cytoplasmic protein [Dichomitus squalens LYA... 55 8e-06 gb|EIW63135.1| cytoplasmic protein [Trametes versicolor FP-10166... 55 8e-06 >gb|EPT02674.1| hypothetical protein FOMPIDRAFT_1117985 [Fomitopsis pinicola FP-58527 SS1] Length = 2185 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSLQ 106 QQVFIGIFPASHI+ RD+LSDAEGRLAE+ ++L+ Sbjct: 129 QQVFIGIFPASHIFIRDQLSDAEGRLAELATTLR 162 >gb|EMD32101.1| hypothetical protein CERSUDRAFT_59129 [Ceriporiopsis subvermispora B] Length = 2031 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHI+ RDELSDAEGRLA+ V +L Sbjct: 120 QQVFIGIFPASHIHIRDELSDAEGRLADFVGAL 152 >ref|XP_001830490.2| cytoplasmic protein [Coprinopsis cinerea okayama7#130] gi|298409540|gb|EAU91370.2| cytoplasmic protein [Coprinopsis cinerea okayama7#130] Length = 2171 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHIY RDELSDAEGRL E+ +L Sbjct: 107 QQVFIGIFPASHIYIRDELSDAEGRLPELARTL 139 >ref|XP_007266957.1| cytoplasmic protein [Fomitiporia mediterranea MF3/22] gi|393217757|gb|EJD03246.1| cytoplasmic protein [Fomitiporia mediterranea MF3/22] Length = 2212 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHI+ RDELSDAEGRLA++ S + Sbjct: 120 QQVFIGIFPASHIHVRDELSDAEGRLADVASQV 152 >ref|XP_007317234.1| hypothetical protein SERLADRAFT_360974 [Serpula lacrymans var. lacrymans S7.9] gi|336371204|gb|EGN99543.1| hypothetical protein SERLA73DRAFT_106135 [Serpula lacrymans var. lacrymans S7.3] gi|336383964|gb|EGO25112.1| hypothetical protein SERLADRAFT_360974 [Serpula lacrymans var. lacrymans S7.9] Length = 2185 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHIY RDELSDAEGRL ++ ++L Sbjct: 123 QQVFIGIFPASHIYVRDELSDAEGRLPDLATAL 155 >gb|ETW80615.1| hypothetical protein HETIRDRAFT_154870 [Heterobasidion irregulare TC 32-1] Length = 2164 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSS 100 QQVFIGIFPASHIY RDEL DAEGRLA++ ++ Sbjct: 122 QQVFIGIFPASHIYIRDELPDAEGRLADVAAA 153 >gb|EPQ57371.1| hypothetical protein GLOTRDRAFT_137711 [Gloeophyllum trabeum ATCC 11539] Length = 2188 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVS 97 QQVFIGIFP+SHIY R+ELSDAEGRLA++ S Sbjct: 122 QQVFIGIFPSSHIYVREELSDAEGRLADLAS 152 >ref|XP_007396743.1| hypothetical protein PHACADRAFT_174540 [Phanerochaete carnosa HHB-10118-sp] gi|409044557|gb|EKM54038.1| hypothetical protein PHACADRAFT_174540 [Phanerochaete carnosa HHB-10118-sp] Length = 2169 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVS 97 QQVF+GIFPASHI+ RDELSDAEGRLA+I + Sbjct: 127 QQVFLGIFPASHIFVRDELSDAEGRLADIAT 157 >ref|XP_007369483.1| cytoplasmic protein [Dichomitus squalens LYAD-421 SS1] gi|395325308|gb|EJF57732.1| cytoplasmic protein [Dichomitus squalens LYAD-421 SS1] Length = 2171 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHI+ RDE+SDAEGRL E+ ++L Sbjct: 123 QQVFIGIFPASHIFVRDEVSDAEGRLTELFNAL 155 >gb|EIW63135.1| cytoplasmic protein [Trametes versicolor FP-101664 SS1] Length = 2168 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 5 QQVFIGIFPASHIYFRDELSDAEGRLAEIVSSL 103 QQVFIGIFPASHI+ RDE+SDAEGRL E+ ++L Sbjct: 123 QQVFIGIFPASHIFVRDEVSDAEGRLTELFNAL 155