BLASTX nr result
ID: Paeonia25_contig00046901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00046901 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588275.1| hypothetical protein MTR_1g005160 [Medicago ... 61 5e-16 >ref|XP_003588275.1| hypothetical protein MTR_1g005160 [Medicago truncatula] gi|355477323|gb|AES58526.1| hypothetical protein MTR_1g005160 [Medicago truncatula] Length = 73 Score = 61.2 bits (147), Expect(3) = 5e-16 Identities = 33/43 (76%), Positives = 34/43 (79%), Gaps = 4/43 (9%) Frame = -1 Query: 179 LNGIVTLKKCLPK----KEGPFSHVVRWSNQRFSSQSNREIFF 63 +N IVT KKCL K KEGPFSHVVR SNQRFSSQS REIFF Sbjct: 31 INRIVTFKKCLLKIKERKEGPFSHVVRRSNQRFSSQSYREIFF 73 Score = 40.4 bits (93), Expect(3) = 5e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 235 AAGGAERTNPRPASFPKPN 179 AAGGAERTNPR ASFPKPN Sbjct: 11 AAGGAERTNPRLASFPKPN 29 Score = 28.1 bits (61), Expect(3) = 5e-16 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 279 MQPQPERSTCA 247 MQPQPERSTCA Sbjct: 1 MQPQPERSTCA 11