BLASTX nr result
ID: Paeonia25_contig00046561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00046561 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007350419.1| hypothetical protein AURDEDRAFT_169448 [Auri... 70 3e-10 >ref|XP_007350419.1| hypothetical protein AURDEDRAFT_169448 [Auricularia delicata TFB-10046 SS5] gi|393233986|gb|EJD41553.1| hypothetical protein AURDEDRAFT_169448 [Auricularia delicata TFB-10046 SS5] Length = 601 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/90 (40%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = +2 Query: 2 ARLTAIVVSFFLCIIAWVTKVIDGVARRLFGPNADLNEGFDDSVSGDKEQNREQLVV-VH 178 A+L ++V+SF L ++AWV K +G+ RRL+G N + +E +D V+ + N +Q V + Sbjct: 444 AKLASVVLSFLLFVVAWVNKTANGIVRRLYGLNPEFSENINDEVNDGETPNNDQFVENIG 503 Query: 179 EIVDRNPSLNCFSKDNPIEISESAKEVPEL 268 E V NP L F K P I E AK+ EL Sbjct: 504 EFVSANPVLERFFKGKPDYIRELAKKATEL 533