BLASTX nr result
ID: Paeonia25_contig00046342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00046342 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007364575.1| SDA1-domain-containing protein [Dichomitus s... 67 2e-09 ref|XP_003035893.1| hypothetical protein SCHCODRAFT_256035 [Schi... 67 2e-09 gb|EIW60689.1| actin cytoskeleton organization and cell cycle pr... 66 6e-09 ref|XP_007310102.1| protein required for actin cytoskeleton orga... 66 6e-09 gb|EPT01810.1| hypothetical protein FOMPIDRAFT_1161029 [Fomitops... 65 1e-08 gb|ETW85642.1| hypothetical protein HETIRDRAFT_154456 [Heterobas... 65 1e-08 ref|XP_007384732.1| protein required for actin cytoskeleton orga... 62 8e-08 emb|CCO33086.1| Protein sda1 [Rhizoctonia solani AG-1 IB] 62 1e-07 gb|ESK96514.1| sda1 family protein [Moniliophthora roreri MCA 2997] 61 2e-07 gb|EUC56238.1| required for actin cytoskeleton organization and ... 60 4e-07 ref|XP_007396105.1| hypothetical protein PHACADRAFT_184558 [Phan... 60 4e-07 ref|XP_007321431.1| hypothetical protein SERLADRAFT_474299 [Serp... 59 5e-07 gb|EMD34495.1| hypothetical protein CERSUDRAFT_159012 [Ceriporio... 59 7e-07 gb|EIW85329.1| protein required for actin cytoskeleton organizat... 57 2e-06 ref|XP_001878661.1| protein required for actin cytoskeleton orga... 57 3e-06 >ref|XP_007364575.1| SDA1-domain-containing protein [Dichomitus squalens LYAD-421 SS1] gi|395330118|gb|EJF62502.1| SDA1-domain-containing protein [Dichomitus squalens LYAD-421 SS1] Length = 772 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTAREDTF 3 TK+LTPADFA+LNDLRI+AA+ AV+ GG + KRK ATLE +K LL+S D F Sbjct: 621 TKILTPADFAMLNDLRIKAASEAVERGGGGSAKRKLATLESQKKSLLASDGNLADAF 677 >ref|XP_003035893.1| hypothetical protein SCHCODRAFT_256035 [Schizophyllum commune H4-8] gi|300109589|gb|EFJ00991.1| hypothetical protein SCHCODRAFT_256035 [Schizophyllum commune H4-8] Length = 926 Score = 67.4 bits (163), Expect = 2e-09 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTAREDTF 3 TK+LTPADFALL DLR+QAAT+AV+ GG + KRK A LE ++K STA EDTF Sbjct: 775 TKILTPADFALLADLRVQAATKAVEAGGGTKAKRKLAALEAAKKAATEVSTA-EDTF 830 >gb|EIW60689.1| actin cytoskeleton organization and cell cycle progression protein [Trametes versicolor FP-101664 SS1] Length = 768 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTAR-EDTF 3 TK+LTPADFA+LN+LRI+AAT AV GG S TKRK A LE RK LL++ ++TF Sbjct: 615 TKILTPADFAMLNELRIKAATDAVAGGGGSGTKRKLAALEAQRKTLLANGDGTLQETF 672 >ref|XP_007310102.1| protein required for actin cytoskeleton organization and cell cycle progression [Stereum hirsutum FP-91666 SS1] gi|389739426|gb|EIM80619.1| protein required for actin cytoskeleton organization and cell cycle progression [Stereum hirsutum FP-91666 SS1] Length = 769 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKIL 36 TK+LTPADFALLNDLR++AA +AV+ GG S+ KRK A+LE S+KIL Sbjct: 618 TKILTPADFALLNDLRLKAAEKAVEAGGGSSAKRKLASLEASKKIL 663 >gb|EPT01810.1| hypothetical protein FOMPIDRAFT_1161029 [Fomitopsis pinicola FP-58527 SS1] Length = 757 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRK 42 TK+LTPADFALLNDLR+QAA++AV+ GG S+ KRK ATLE ++K Sbjct: 607 TKILTPADFALLNDLRLQAASQAVERGGGSSAKRKLATLEANKK 650 >gb|ETW85642.1| hypothetical protein HETIRDRAFT_154456 [Heterobasidion irregulare TC 32-1] Length = 750 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSS 24 TK+LTPADFALLNDLR++AAT+ V+ GG +A KRK A LE S+K + S++ Sbjct: 599 TKILTPADFALLNDLRLKAATKEVESGGGNAAKRKLAVLEASKKAMSSNA 648 >ref|XP_007384732.1| protein required for actin cytoskeleton organization and cell cycle progression [Punctularia strigosozonata HHB-11173 SS5] gi|390598231|gb|EIN07629.1| protein required for actin cytoskeleton organization and cell cycle progression [Punctularia strigosozonata HHB-11173 SS5] Length = 747 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTA 18 TK+LTPADF LLN+L++QAAT+AV+ G+S+ KRK ATLE +K + S + A Sbjct: 597 TKILTPADFTLLNELKLQAATKAVEATGSSSAKRKLATLEAQKKNMASGNMA 648 >emb|CCO33086.1| Protein sda1 [Rhizoctonia solani AG-1 IB] Length = 711 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKI 39 TK+LTPADFALLN+LRIQAAT+ + GG +A KRK A LE +K+ Sbjct: 617 TKILTPADFALLNELRIQAATKEAESGGGTAAKRKLAALEAQKKV 661 >gb|ESK96514.1| sda1 family protein [Moniliophthora roreri MCA 2997] Length = 739 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSR 45 TK+LTPADFALLNDLRIQAA+RAV GG + KRK A LE ++ Sbjct: 590 TKILTPADFALLNDLRIQAASRAVDAGGGTRAKRKLAALEANK 632 >gb|EUC56238.1| required for actin cytoskeleton organization and cell cycle progression protein [Rhizoctonia solani AG-3 Rhs1AP] Length = 765 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRK 42 TK+LTPADFALLN+LRI+AAT+ + GG SA KRK A LE +K Sbjct: 617 TKILTPADFALLNELRIKAATKEAESGGGSAAKRKLAALEAHKK 660 >ref|XP_007396105.1| hypothetical protein PHACADRAFT_184558 [Phanerochaete carnosa HHB-10118-sp] gi|409046308|gb|EKM55788.1| hypothetical protein PHACADRAFT_184558 [Phanerochaete carnosa HHB-10118-sp] Length = 761 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTAREDTF 3 TK+LTPADFALLN+LRI+ T+ V+ GG SA KRK LE ++K + T E+TF Sbjct: 611 TKILTPADFALLNELRIKEVTQKVEHGGGSAAKRKLVALEANKKAFSQAGT--EETF 665 >ref|XP_007321431.1| hypothetical protein SERLADRAFT_474299 [Serpula lacrymans var. lacrymans S7.9] gi|336363638|gb|EGN92016.1| hypothetical protein SERLA73DRAFT_191723 [Serpula lacrymans var. lacrymans S7.3] gi|336380492|gb|EGO21645.1| hypothetical protein SERLADRAFT_474299 [Serpula lacrymans var. lacrymans S7.9] Length = 744 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRK 42 TK+LTPADFALLN+LR+QAAT+AV+ GG KRK A LE + K Sbjct: 594 TKILTPADFALLNELRLQAATKAVEAGGGPKAKRKLAELEANAK 637 >gb|EMD34495.1| hypothetical protein CERSUDRAFT_159012 [Ceriporiopsis subvermispora B] Length = 761 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRK 42 TK+LTPADFALLNDLRI+AA+ AV+ G S KRK A+LE +K Sbjct: 611 TKILTPADFALLNDLRIKAASAAVERGAGSGAKRKLASLEAQKK 654 >gb|EIW85329.1| protein required for actin cytoskeleton organization and cell cycle progression [Coniophora puteana RWD-64-598 SS2] Length = 739 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 173 TKVLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLE 54 TK+LTPADFALLNDLRI+AA++AV+ GG S KRK A L+ Sbjct: 591 TKILTPADFALLNDLRIKAASKAVEAGGGSHAKRKLAELQ 630 >ref|XP_001878661.1| protein required for actin cytoskeleton organization and cell cycle progression [Laccaria bicolor S238N-H82] gi|164647115|gb|EDR11360.1| protein required for actin cytoskeleton organization and cell cycle progression [Laccaria bicolor S238N-H82] Length = 721 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/55 (60%), Positives = 35/55 (63%) Frame = -2 Query: 167 VLTPADFALLNDLRIQAATRAVK*GGASATKRKFATLEPSRKILLSSSTAREDTF 3 +LTPADFALLNDLRIQAA AV GG S KRK A LE I L +DTF Sbjct: 572 ILTPADFALLNDLRIQAAKTAVGSGGGSQAKRKLAALEAGHSI-LPPDRQLQDTF 625