BLASTX nr result
ID: Paeonia25_contig00046164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00046164 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30565.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002270135.1| PREDICTED: uncharacterized protein LOC100247... 66 6e-09 >emb|CBI30565.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +1 Query: 304 NRNSAENNVVDLVEGEVLQEPWEHHRPQKMARYCVSEVNETSPLAVVK 447 N +S E ++ +GEVL EPW HHRPQK+AR C+SE++ETSPL+VVK Sbjct: 133 NHHSGEKDIRFSPQGEVLHEPWIHHRPQKIARTCISELSETSPLSVVK 180 >ref|XP_002270135.1| PREDICTED: uncharacterized protein LOC100247771 [Vitis vinifera] Length = 292 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +1 Query: 304 NRNSAENNVVDLVEGEVLQEPWEHHRPQKMARYCVSEVNETSPLAVVK 447 N +S E ++ +GEVL EPW HHRPQK+AR C+SE++ETSPL+VVK Sbjct: 63 NHHSGEKDIRFSPQGEVLHEPWIHHRPQKIARTCISELSETSPLSVVK 110