BLASTX nr result
ID: Paeonia25_contig00046007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00046007 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD38982.1| hypothetical protein CERSUDRAFT_93021 [Ceriporiop... 57 2e-06 >gb|EMD38982.1| hypothetical protein CERSUDRAFT_93021 [Ceriporiopsis subvermispora B] Length = 208 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +2 Query: 365 YCSSDPDAMDSEPVSSPDDTYKIRLSRILLWRDEFAKATGTRLS 496 YCSSDP+ +D+ S PDDTYK R +R+L WR+ FAK G +S Sbjct: 80 YCSSDPEELDAARESMPDDTYKTRQNRVLAWRETFAKGVGATVS 123