BLASTX nr result
ID: Paeonia25_contig00045918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045918 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027659.1| Pleiotropic drug resistance 11 isoform 1 [Th... 40 2e-06 ref|XP_007027660.1| Pleiotropic drug resistance 11 isoform 2 [Th... 40 2e-06 ref|XP_007027661.1| Pleiotropic drug resistance 11 isoform 3 [Th... 40 2e-06 ref|XP_007023609.1| Pleiotropic drug resistance 11 [Theobroma ca... 38 6e-06 >ref|XP_007027659.1| Pleiotropic drug resistance 11 isoform 1 [Theobroma cacao] gi|508716264|gb|EOY08161.1| Pleiotropic drug resistance 11 isoform 1 [Theobroma cacao] Length = 1460 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 178 LPFQPLPFAFNNVNYYIDMP 119 LPFQPL AFN++NYY+DMP Sbjct: 852 LPFQPLSLAFNHINYYVDMP 871 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 329 DSKAVVVDENTDKENQQ*FFEAEALQGVNVAVKRSS-IVGVVDDVPRRGM 183 DSKAVVV++N + + + + +G N V+ SS IVG PR+GM Sbjct: 801 DSKAVVVNDNENNKTKNPYSAGRRPEGTNQQVRNSSDIVGAAGHAPRKGM 850 >ref|XP_007027660.1| Pleiotropic drug resistance 11 isoform 2 [Theobroma cacao] gi|508716265|gb|EOY08162.1| Pleiotropic drug resistance 11 isoform 2 [Theobroma cacao] Length = 1309 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 178 LPFQPLPFAFNNVNYYIDMP 119 LPFQPL AFN++NYY+DMP Sbjct: 852 LPFQPLSLAFNHINYYVDMP 871 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 329 DSKAVVVDENTDKENQQ*FFEAEALQGVNVAVKRSS-IVGVVDDVPRRGM 183 DSKAVVV++N + + + + +G N V+ SS IVG PR+GM Sbjct: 801 DSKAVVVNDNENNKTKNPYSAGRRPEGTNQQVRNSSDIVGAAGHAPRKGM 850 >ref|XP_007027661.1| Pleiotropic drug resistance 11 isoform 3 [Theobroma cacao] gi|508716266|gb|EOY08163.1| Pleiotropic drug resistance 11 isoform 3 [Theobroma cacao] Length = 1289 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 178 LPFQPLPFAFNNVNYYIDMP 119 LPFQPL AFN++NYY+DMP Sbjct: 852 LPFQPLSLAFNHINYYVDMP 871 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 329 DSKAVVVDENTDKENQQ*FFEAEALQGVNVAVKRSS-IVGVVDDVPRRGM 183 DSKAVVV++N + + + + +G N V+ SS IVG PR+GM Sbjct: 801 DSKAVVVNDNENNKTKNPYSAGRRPEGTNQQVRNSSDIVGAAGHAPRKGM 850 >ref|XP_007023609.1| Pleiotropic drug resistance 11 [Theobroma cacao] gi|508778975|gb|EOY26231.1| Pleiotropic drug resistance 11 [Theobroma cacao] Length = 1452 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 178 LPFQPLPFAFNNVNYYIDMP 119 LPF PL AFN+VNYY+DMP Sbjct: 844 LPFLPLSLAFNHVNYYVDMP 863 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = -3 Query: 329 DSKAVVVDENTDKENQQ*FFEAEALQGVNVAVKRSSIVG-VVDDVPRRGM 183 DSKA+VVD++ K+N++ F +G +V+ SS V VVD R+GM Sbjct: 793 DSKAIVVDKDETKKNEESFSGQHTEEGTATSVRNSSNVSHVVDRATRKGM 842