BLASTX nr result
ID: Paeonia25_contig00045877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045877 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD42193.1| hypothetical protein CERSUDRAFT_147823 [Ceriporio... 63 5e-08 >gb|EMD42193.1| hypothetical protein CERSUDRAFT_147823 [Ceriporiopsis subvermispora B] Length = 600 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -1 Query: 195 AKMPKDTRRRTGGHEPSVKLSKRNFAVQDNAVEPIAVDVEPTNASGTEILQSLAAAEHQK 16 A +PK+TRRR G H PS KLS R FAVQ NAVE + V E ++ SG EIL S+A E Sbjct: 394 AAIPKETRRRAGAHAPSAKLSSRQFAVQSNAVEHVEVG-EQSDKSGAEILHSMAEPEEPP 452 Query: 15 V 13 + Sbjct: 453 I 453