BLASTX nr result
ID: Paeonia25_contig00045822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045822 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD33795.1| hypothetical protein CERSUDRAFT_87123 [Ceriporiop... 66 4e-11 ref|XP_007397530.1| hypothetical protein PHACADRAFT_259011 [Phan... 57 2e-08 ref|XP_007362255.1| general substrate transporter [Dichomitus sq... 55 6e-08 ref|XP_007309749.1| hexose transporter [Stereum hirsutum FP-9166... 56 1e-07 ref|XP_001832384.1| hexose transporter [Coprinopsis cinerea okay... 55 4e-07 gb|ESK93237.1| hexose transporter [Moniliophthora roreri MCA 2997] 50 5e-06 gb|EIW63670.1| hexose transporter [Trametes versicolor FP-101664... 49 6e-06 gb|EIW83369.1| hexose transporter [Coniophora puteana RWD-64-598... 50 6e-06 >gb|EMD33795.1| hypothetical protein CERSUDRAFT_87123 [Ceriporiopsis subvermispora B] Length = 528 Score = 66.2 bits (160), Expect(2) = 4e-11 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPAAV+ GGN + HLVD S+PW+ NRRL+ALNGWILLL + Sbjct: 3 GPAAVSAGGNNAFTHLVDSSKPWWMNRRLLALNGWILLLLI 43 Score = 26.9 bits (58), Expect(2) = 4e-11 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITSTTNGYDG Sbjct: 42 LITSTTNGYDG 52 >ref|XP_007397530.1| hypothetical protein PHACADRAFT_259011 [Phanerochaete carnosa HHB-10118-sp] gi|409045374|gb|EKM54855.1| hypothetical protein PHACADRAFT_259011 [Phanerochaete carnosa HHB-10118-sp] Length = 526 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 287 GPAAVN-TGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPAAV TGG Q +AHLVD RPW+KNRRL+ALN WI LL + Sbjct: 3 GPAAVTATGGQQAFAHLVD-PRPWWKNRRLIALNAWITLLLI 43 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITSTTNGYDG Sbjct: 42 LITSTTNGYDG 52 >ref|XP_007362255.1| general substrate transporter [Dichomitus squalens LYAD-421 SS1] gi|395333241|gb|EJF65619.1| general substrate transporter [Dichomitus squalens LYAD-421 SS1] Length = 528 Score = 55.5 bits (132), Expect(2) = 6e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPAAV+T Q YAHL+D SRPW+KN RL+ LN ILLL + Sbjct: 3 GPAAVSTDNGQGYAHLIDKSRPWWKNTRLIKLNLCILLLLI 43 Score = 26.9 bits (58), Expect(2) = 6e-08 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITSTTNGYDG Sbjct: 42 LITSTTNGYDG 52 >ref|XP_007309749.1| hexose transporter [Stereum hirsutum FP-91666 SS1] gi|389739875|gb|EIM81067.1| hexose transporter [Stereum hirsutum FP-91666 SS1] Length = 550 Score = 55.8 bits (133), Expect(2) = 1e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPA V+ N YA L+D SRPW+KN RLMALNGWILLL + Sbjct: 4 GPAIVSK--NDSYAGLIDTSRPWWKNGRLMALNGWILLLLI 42 Score = 25.4 bits (54), Expect(2) = 1e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITS+TNGYDG Sbjct: 41 LITSSTNGYDG 51 >ref|XP_001832384.1| hexose transporter [Coprinopsis cinerea okayama7#130] gi|116506523|gb|EAU89418.1| hexose transporter [Coprinopsis cinerea okayama7#130] Length = 522 Score = 55.5 bits (132), Expect(2) = 4e-07 Identities = 23/41 (56%), Positives = 30/41 (73%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 G A + GGN +AHLVD +R WY N+R++ALNGWI LL + Sbjct: 3 GGAVASAGGNGGFAHLVDPNRKWYNNKRIIALNGWIFLLLI 43 Score = 24.3 bits (51), Expect(2) = 4e-07 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 118 FNRLITSTTNGYDG 77 F LITS+TNG+DG Sbjct: 39 FLLLITSSTNGFDG 52 >gb|ESK93237.1| hexose transporter [Moniliophthora roreri MCA 2997] Length = 522 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 20/41 (48%), Positives = 30/41 (73%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 G AA++ G + +AHLVD ++ WY NRRL+ LN W++LL + Sbjct: 3 GGAAISGGADSGFAHLVDPNKKWYNNRRLIVLNAWLVLLLI 43 Score = 25.4 bits (54), Expect(2) = 5e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITS+TNGYDG Sbjct: 42 LITSSTNGYDG 52 >gb|EIW63670.1| hexose transporter [Trametes versicolor FP-101664 SS1] Length = 538 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPAAV+ G Q YAHL+ +PWYKN R++ LN I LL + Sbjct: 3 GPAAVSAGNGQGYAHLIKDHKPWYKNPRMIKLNLCIALLLI 43 Score = 26.9 bits (58), Expect(2) = 6e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITSTTNGYDG Sbjct: 42 LITSTTNGYDG 52 >gb|EIW83369.1| hexose transporter [Coniophora puteana RWD-64-598 SS2] Length = 505 Score = 50.1 bits (118), Expect(2) = 6e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = -1 Query: 287 GPAAVNTGGNQHYAHLVDLSRPWYKNRRLMALNGWILLLSV 165 GPA + Y+HL+D SRPW+KN+RL+ LN WIL+L + Sbjct: 4 GPALTSANLVPSYSHLIDRSRPWWKNKRLVLLNFWILVLLI 44 Score = 25.4 bits (54), Expect(2) = 6e-06 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 109 LITSTTNGYDG 77 LITSTTNG+DG Sbjct: 43 LITSTTNGFDG 53