BLASTX nr result
ID: Paeonia25_contig00045800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045800 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007362629.1| hypothetical protein DICSQDRAFT_80562 [Dicho... 56 5e-06 >ref|XP_007362629.1| hypothetical protein DICSQDRAFT_80562 [Dichomitus squalens LYAD-421 SS1] gi|395332454|gb|EJF64833.1| hypothetical protein DICSQDRAFT_80562 [Dichomitus squalens LYAD-421 SS1] Length = 374 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = +1 Query: 94 DVVSGEQYRYALTNFRIAHXXXXXXXXXXXXXXXXXALLRARIALLEG 237 D+VSGEQYRYALTNFRIAH ALLRARIALLEG Sbjct: 8 DIVSGEQYRYALTNFRIAHEKVEEQRVQLQEQEKQVALLRARIALLEG 55