BLASTX nr result
ID: Paeonia25_contig00045785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045785 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299635.1| PREDICTED: uncharacterized protein LOC101315... 60 3e-07 gb|EXC06702.1| hypothetical protein L484_021540 [Morus notabilis] 55 8e-06 >ref|XP_004299635.1| PREDICTED: uncharacterized protein LOC101315051 [Fragaria vesca subsp. vesca] Length = 144 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +3 Query: 90 MLLGKRPRPYMKRTTSMNAITFDLDGTEEPQPSDPQLNPKKQVA 221 MLLGKRPRP MKRTTSM+ ITFDL +PQPSDP LNP +A Sbjct: 1 MLLGKRPRPPMKRTTSMSEITFDLSTEAQPQPSDP-LNPFSPLA 43 >gb|EXC06702.1| hypothetical protein L484_021540 [Morus notabilis] Length = 165 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 7/58 (12%) Frame = +3 Query: 90 MLLGKRPRPYMKRTTSMNAITFDLDGTEE---PQPSDP----QLNPKKQVAGLVAPHN 242 MLLGKRPRP MKRTTSM ITFDL +E QPSDP +++ ++Q L+A HN Sbjct: 1 MLLGKRPRPPMKRTTSMTEITFDLSTNDEMMSSQPSDPHNPFKVDVRQQDQRLLAAHN 58