BLASTX nr result
ID: Paeonia25_contig00045612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045612 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001878377.1| predicted protein [Laccaria bicolor S238N-H8... 58 1e-06 gb|ESK82809.1| c2 domain-containing [Moniliophthora roreri MCA 2... 57 3e-06 >ref|XP_001878377.1| predicted protein [Laccaria bicolor S238N-H82] gi|164646831|gb|EDR11076.1| predicted protein [Laccaria bicolor S238N-H82] Length = 310 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 195 LEIDYVDLIILFKRATGLPKMDHSGFADPYFIANLDGKVTFV 320 LEI Y+DL + F A+GLPKMD G ADPYF+ANLDGK++F+ Sbjct: 46 LEIPYIDLQMQFIGASGLPKMDIVGSADPYFVANLDGKLSFM 87 >gb|ESK82809.1| c2 domain-containing [Moniliophthora roreri MCA 2997] Length = 491 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +3 Query: 189 KMLEIDYVDLIILFKRATGLPKMDHSGFADPYFIANLDGKVTFV 320 K+L++ YVDL I F A+G+PKMD G ADPYF+A LD +++FV Sbjct: 42 KLLDVPYVDLTIQFIGASGIPKMDVVGSADPYFVAKLDNRISFV 85