BLASTX nr result
ID: Paeonia25_contig00045567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045567 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306951.1| PREDICTED: spindle and kinetochore-associate... 62 6e-08 ref|XP_006375283.1| hypothetical protein POPTR_0014s05890g [Popu... 62 8e-08 ref|XP_002274132.1| PREDICTED: spindle and kinetochore-associate... 61 2e-07 emb|CAN69643.1| hypothetical protein VITISV_028571 [Vitis vinifera] 61 2e-07 ref|XP_006841162.1| hypothetical protein AMTR_s00086p00155510 [A... 60 3e-07 ref|XP_006345520.1| PREDICTED: spindle and kinetochore-associate... 60 4e-07 ref|XP_007134804.1| hypothetical protein PHAVU_010G0777001g [Pha... 60 4e-07 ref|XP_007134803.1| hypothetical protein PHAVU_010G0777001g, par... 60 4e-07 ref|XP_006445311.1| hypothetical protein CICLE_v10021687mg [Citr... 60 4e-07 ref|XP_004240054.1| PREDICTED: spindle and kinetochore-associate... 60 4e-07 ref|XP_003516443.1| PREDICTED: spindle and kinetochore-associate... 59 5e-07 ref|XP_006658560.1| PREDICTED: spindle and kinetochore-associate... 59 9e-07 ref|XP_006290477.1| hypothetical protein CARUB_v100178540mg, par... 57 2e-06 ref|NP_191625.1| spindle and kinetochore-associated protein 1-li... 57 2e-06 ref|XP_002876574.1| hypothetical protein ARALYDRAFT_486539 [Arab... 57 2e-06 ref|XP_004516030.1| PREDICTED: spindle and kinetochore-associate... 57 3e-06 ref|XP_004957707.1| PREDICTED: spindle and kinetochore-associate... 56 6e-06 ref|XP_004139626.1| PREDICTED: spindle and kinetochore-associate... 56 6e-06 ref|XP_003563113.1| PREDICTED: spindle and kinetochore-associate... 56 6e-06 >ref|XP_004306951.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Fragaria vesca subsp. vesca] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGR+SETRIGHHRVIIL KPH Sbjct: 238 TGKAILTVLRHLGRVSETRIGHHRVIILLKPH 269 >ref|XP_006375283.1| hypothetical protein POPTR_0014s05890g [Populus trichocarpa] gi|550323602|gb|ERP53080.1| hypothetical protein POPTR_0014s05890g [Populus trichocarpa] Length = 206 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TG++ILTVLRHLGRISETRIGHHRVIILSKP Sbjct: 174 TGKAILTVLRHLGRISETRIGHHRVIILSKP 204 >ref|XP_002274132.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Vitis vinifera] gi|296089173|emb|CBI38876.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TGR+ILTVLRHLGRISE RIGHHRVIILSKP Sbjct: 238 TGRAILTVLRHLGRISEIRIGHHRVIILSKP 268 >emb|CAN69643.1| hypothetical protein VITISV_028571 [Vitis vinifera] Length = 279 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TGR+ILTVLRHLGRISE RIGHHRVIILSKP Sbjct: 248 TGRAILTVLRHLGRISEIRIGHHRVIILSKP 278 >ref|XP_006841162.1| hypothetical protein AMTR_s00086p00155510 [Amborella trichopoda] gi|548843056|gb|ERN02837.1| hypothetical protein AMTR_s00086p00155510 [Amborella trichopoda] Length = 272 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TG++ILTVLRHLGRI ETRIGHHRVIILSKP Sbjct: 240 TGKAILTVLRHLGRIHETRIGHHRVIILSKP 270 >ref|XP_006345520.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Solanum tuberosum] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILT+LRHLGRISETRIGHHRVI+L +PH Sbjct: 234 TGKAILTLLRHLGRISETRIGHHRVILLLRPH 265 >ref|XP_007134804.1| hypothetical protein PHAVU_010G0777001g [Phaseolus vulgaris] gi|561007849|gb|ESW06798.1| hypothetical protein PHAVU_010G0777001g [Phaseolus vulgaris] Length = 181 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRI+ETRIGH+RVIIL KPH Sbjct: 150 TGKAILTVLRHLGRINETRIGHNRVIILQKPH 181 >ref|XP_007134803.1| hypothetical protein PHAVU_010G0777001g, partial [Phaseolus vulgaris] gi|561007848|gb|ESW06797.1| hypothetical protein PHAVU_010G0777001g, partial [Phaseolus vulgaris] Length = 196 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRI+ETRIGH+RVIIL KPH Sbjct: 165 TGKAILTVLRHLGRINETRIGHNRVIILQKPH 196 >ref|XP_006445311.1| hypothetical protein CICLE_v10021687mg [Citrus clementina] gi|568875579|ref|XP_006490870.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Citrus sinensis] gi|557547573|gb|ESR58551.1| hypothetical protein CICLE_v10021687mg [Citrus clementina] Length = 268 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TG++ILTVLRHLGRISETRIGHHRVIIL KP Sbjct: 237 TGKAILTVLRHLGRISETRIGHHRVIILLKP 267 >ref|XP_004240054.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Solanum lycopersicum] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILT+LRHLGRISETRIGHHRVI+L +PH Sbjct: 234 TGKAILTLLRHLGRISETRIGHHRVILLLRPH 265 >ref|XP_003516443.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Glycine max] Length = 270 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRI+ETR+GH+RVIIL KPH Sbjct: 239 TGKAILTVLRHLGRINETRVGHNRVIILQKPH 270 >ref|XP_006658560.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Oryza brachyantha] Length = 259 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRI ETRIGHHRV ILSK H Sbjct: 228 TGKAILTVLRHLGRIHETRIGHHRVFILSKQH 259 >ref|XP_006290477.1| hypothetical protein CARUB_v100178540mg, partial [Capsella rubella] gi|482559184|gb|EOA23375.1| hypothetical protein CARUB_v100178540mg, partial [Capsella rubella] Length = 63 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRISETRIG +RVIIL KPH Sbjct: 32 TGKAILTVLRHLGRISETRIGQNRVIILMKPH 63 >ref|NP_191625.1| spindle and kinetochore-associated protein 1-like protein [Arabidopsis thaliana] gi|75181374|sp|Q9LZZ7.1|SKA1_ARATH RecName: Full=Spindle and kinetochore-associated protein 1 homolog gi|7329676|emb|CAB82670.1| putative protein [Arabidopsis thaliana] gi|26450283|dbj|BAC42258.1| unknown protein [Arabidopsis thaliana] gi|28827580|gb|AAO50634.1| unknown protein [Arabidopsis thaliana] gi|332646573|gb|AEE80094.1| spindle and kinetochore-associated protein 1-like protein [Arabidopsis thaliana] Length = 272 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRISETRIG +RVIIL KPH Sbjct: 241 TGKAILTVLRHLGRISETRIGQNRVIILMKPH 272 >ref|XP_002876574.1| hypothetical protein ARALYDRAFT_486539 [Arabidopsis lyrata subsp. lyrata] gi|297322412|gb|EFH52833.1| hypothetical protein ARALYDRAFT_486539 [Arabidopsis lyrata subsp. lyrata] Length = 272 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGRISETRIG +RVIIL KPH Sbjct: 241 TGKAILTVLRHLGRISETRIGQNRVIILMKPH 272 >ref|XP_004516030.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Cicer arietinum] Length = 272 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKPH 206 TG++ILTVLRHLGR +E+R+GHHRV IL KPH Sbjct: 241 TGKAILTVLRHLGRFNESRVGHHRVFILHKPH 272 >ref|XP_004957707.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Setaria italica] Length = 276 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSK 212 TG++ILTVLRHLGRI ETRIGHHRV ILSK Sbjct: 245 TGKAILTVLRHLGRIHETRIGHHRVFILSK 274 >ref|XP_004139626.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Cucumis sativus] gi|449475389|ref|XP_004154437.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Cucumis sativus] Length = 269 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSKP 209 TG++ILTVLRHLGRISETRIGH RVI+L KP Sbjct: 238 TGKAILTVLRHLGRISETRIGHQRVILLLKP 268 >ref|XP_003563113.1| PREDICTED: spindle and kinetochore-associated protein 1 homolog [Brachypodium distachyon] Length = 276 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 301 TGRSILTVLRHLGRISETRIGHHRVIILSK 212 TG++ILTVLRHLGRI ETRIGHHRV ILSK Sbjct: 245 TGKAILTVLRHLGRIHETRIGHHRVFILSK 274