BLASTX nr result
ID: Paeonia25_contig00045534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045534 (598 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007362267.1| hypothetical protein DICSQDRAFT_166635 [Dich... 59 1e-06 >ref|XP_007362267.1| hypothetical protein DICSQDRAFT_166635 [Dichomitus squalens LYAD-421 SS1] gi|395332092|gb|EJF64471.1| hypothetical protein DICSQDRAFT_166635 [Dichomitus squalens LYAD-421 SS1] Length = 975 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = -3 Query: 476 PETPGLISNVLSFVSREIESFVRTAAGGSSNEVQQKQRPLASSSRVKLD 330 P PGL+++ SFVSRE+ESFV A GG EVQQK +P ASSSRV LD Sbjct: 9 PAAPGLLASAFSFVSRELESFVTAATGG---EVQQKTQPQASSSRVTLD 54