BLASTX nr result
ID: Paeonia25_contig00045506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045506 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34899.1| Metal transporter Nramp5 [Morus notabilis] 58 1e-06 >gb|EXC34899.1| Metal transporter Nramp5 [Morus notabilis] Length = 337 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 216 MSNQLVRLNAFRGEPANSGFK*HFTPNHNSSA 311 MS+QL+ LNAFRGEPA+SGF+ HFTPNHNSSA Sbjct: 284 MSSQLLHLNAFRGEPASSGFEWHFTPNHNSSA 315