BLASTX nr result
ID: Paeonia25_contig00045388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045388 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34146.1| hypothetical protein CERSUDRAFT_159621 [Ceriporio... 127 2e-27 gb|EIW57321.1| hypothetical protein TRAVEDRAFT_169007 [Trametes ... 112 5e-23 gb|EIW84019.1| hypothetical protein CONPUDRAFT_119568 [Coniophor... 106 4e-21 ref|XP_007362455.1| hypothetical protein DICSQDRAFT_52097, parti... 103 2e-20 gb|EPT05645.1| hypothetical protein FOMPIDRAFT_40918, partial [F... 97 3e-18 ref|XP_007262691.1| hypothetical protein FOMMEDRAFT_16996 [Fomit... 89 6e-16 ref|XP_007371087.1| hypothetical protein DICSQDRAFT_93916 [Dicho... 87 2e-15 ref|XP_001880673.1| predicted protein [Laccaria bicolor S238N-H8... 87 2e-15 gb|ETW83099.1| hypothetical protein HETIRDRAFT_163506 [Heterobas... 86 5e-15 ref|XP_007299400.1| hypothetical protein STEHIDRAFT_50135, parti... 82 8e-14 gb|EIW53988.1| hypothetical protein TRAVEDRAFT_131983, partial [... 79 5e-13 ref|XP_007399117.1| hypothetical protein PHACADRAFT_261410 [Phan... 73 5e-11 ref|XP_007322929.1| hypothetical protein SERLADRAFT_477549 [Serp... 71 2e-10 gb|EUC64317.1| hypothetical protein RSOL_439070, partial [Rhizoc... 69 5e-10 gb|EPQ54258.1| hypothetical protein GLOTRDRAFT_27801, partial [G... 69 7e-10 ref|XP_006455725.1| hypothetical protein AGABI2DRAFT_76734 [Agar... 69 9e-10 ref|XP_007386943.1| hypothetical protein PUNSTDRAFT_91335 [Punct... 68 1e-09 gb|EIW76834.1| hypothetical protein CONPUDRAFT_157988 [Coniophor... 65 8e-09 ref|XP_001880055.1| predicted protein [Laccaria bicolor S238N-H8... 65 8e-09 gb|EPT02432.1| hypothetical protein FOMPIDRAFT_1087248, partial ... 63 5e-08 >gb|EMD34146.1| hypothetical protein CERSUDRAFT_159621 [Ceriporiopsis subvermispora B] Length = 83 Score = 127 bits (318), Expect = 2e-27 Identities = 54/74 (72%), Positives = 58/74 (78%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC QECFGNQHRGCGHYV YYSG + DCE+P C LS HMHKT +NC CN R+ D RRV Sbjct: 1 MCIQECFGNQHRGCGHYVVSYYSGERWDCESPTCKLSKNHMHKTAKNCDCNTRWTDRRRV 60 Query: 244 MNLIQEPCDECKEA 285 NLIQEPCD CKEA Sbjct: 61 QNLIQEPCDACKEA 74 >gb|EIW57321.1| hypothetical protein TRAVEDRAFT_169007 [Trametes versicolor FP-101664 SS1] Length = 83 Score = 112 bits (280), Expect = 5e-23 Identities = 47/74 (63%), Positives = 57/74 (77%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC +EC GNQHRGC H+VT+YYSG + DC +P CALS+ H H +NC CNR + D R+V Sbjct: 1 MCFEECCGNQHRGCPHFVTLYYSGEKFDCLSPACALSSAHAHPGNRNCGCNRAFRDRRKV 60 Query: 244 MNLIQEPCDECKEA 285 +NLIQEPCD CKEA Sbjct: 61 LNLIQEPCDACKEA 74 >gb|EIW84019.1| hypothetical protein CONPUDRAFT_119568 [Coniophora puteana RWD-64-598 SS2] Length = 91 Score = 106 bits (264), Expect = 4e-21 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MCS ECFG+Q+RGCGHYV +Y +G+ DC+ P C LS+ HMHKT +NC CN Y D RRV Sbjct: 1 MCSMECFGDQYRGCGHYVRVYQTGITYDCKQPQCKLSSAHMHKTARNCGCNTEYADHRRV 60 Query: 244 MNLIQEPCDECK 279 NL Q C+ C+ Sbjct: 61 QNLFQTKCEACQ 72 >ref|XP_007362455.1| hypothetical protein DICSQDRAFT_52097, partial [Dichomitus squalens LYAD-421 SS1] gi|395332280|gb|EJF64659.1| hypothetical protein DICSQDRAFT_52097, partial [Dichomitus squalens LYAD-421 SS1] Length = 76 Score = 103 bits (257), Expect = 2e-20 Identities = 42/67 (62%), Positives = 52/67 (77%) Frame = +1 Query: 85 GNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMNLIQEP 264 GNQHRGC H+V +YYSG + DC +PNC LS++H H +NCPC + Y + RRV+NLIQEP Sbjct: 1 GNQHRGCPHFVILYYSGEKWDCGSPNCGLSSQHAHPNARNCPCPKAYRERRRVLNLIQEP 60 Query: 265 CDECKEA 285 CD CKEA Sbjct: 61 CDACKEA 67 >gb|EPT05645.1| hypothetical protein FOMPIDRAFT_40918, partial [Fomitopsis pinicola FP-58527 SS1] Length = 77 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/68 (63%), Positives = 49/68 (72%) Frame = +1 Query: 82 FGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMNLIQE 261 FGNQHRGCGH+V YYSGV DC+ P+C LS+ H H T +C C + D RRV NLIQE Sbjct: 1 FGNQHRGCGHFVVSYYSGVTMDCKRPDCKLSSAHKH-TALSCGCPSVWHDHRRVQNLIQE 59 Query: 262 PCDECKEA 285 PCD CKEA Sbjct: 60 PCDNCKEA 67 >ref|XP_007262691.1| hypothetical protein FOMMEDRAFT_16996 [Fomitiporia mediterranea MF3/22] gi|393220942|gb|EJD06427.1| hypothetical protein FOMMEDRAFT_16996 [Fomitiporia mediterranea MF3/22] Length = 81 Score = 89.0 bits (219), Expect = 6e-16 Identities = 35/74 (47%), Positives = 51/74 (68%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC+ ECFG+ +RGC HYV YYSG + DC +P+C S++H HK+ ++C C + D +RV Sbjct: 1 MCTYECFGDYYRGCQHYVIRYYSGERADCMSPDCKTSSEHKHKSARDCVCPKVQLDNKRV 60 Query: 244 MNLIQEPCDECKEA 285 +N+ Q CD C E+ Sbjct: 61 VNMFQFKCDTCMES 74 >ref|XP_007371087.1| hypothetical protein DICSQDRAFT_93916 [Dichomitus squalens LYAD-421 SS1] gi|395323706|gb|EJF56166.1| hypothetical protein DICSQDRAFT_93916 [Dichomitus squalens LYAD-421 SS1] Length = 88 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 1/75 (1%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQN-CPCNRRYFDVRR 240 MC ECFGN HRGC HYV +Y SG +TDC + +CALS H H+ Q C C++ + RR Sbjct: 1 MCEIECFGNYHRGCEHYVKLYESGNKTDCGSASCALSVAHQHRPGQRVCTCSKVPRECRR 60 Query: 241 VMNLIQEPCDECKEA 285 V++LI E CD C A Sbjct: 61 VLSLIHERCDNCTRA 75 >ref|XP_001880673.1| predicted protein [Laccaria bicolor S238N-H82] gi|164644198|gb|EDR08448.1| predicted protein [Laccaria bicolor S238N-H82] Length = 78 Score = 87.4 bits (215), Expect = 2e-15 Identities = 34/72 (47%), Positives = 49/72 (68%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E FG+ +RGCGH++ YYSG + DC + C +S+ H+HK NC CN+ +D +RV Sbjct: 1 MCELEVFGDYYRGCGHFIRSYYSGEKFDCNSQTCGISSAHIHKA-PNCRCNKTPYDHQRV 59 Query: 244 MNLIQEPCDECK 279 +N+ PCDEC+ Sbjct: 60 VNMFHTPCDECR 71 >gb|ETW83099.1| hypothetical protein HETIRDRAFT_163506 [Heterobasidion irregulare TC 32-1] Length = 94 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = +1 Query: 109 HYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMNLIQEPCDECKEA 285 HYV +Y +G TDC +P+CA S HMHKT + C C+R +D RRV+NL QEPCD+CKEA Sbjct: 28 HYVRLYSTGNTTDCNSPHCAFSAAHMHKTARTCMCHRVMYDDRRVLNLFQEPCDDCKEA 86 >ref|XP_007299400.1| hypothetical protein STEHIDRAFT_50135, partial [Stereum hirsutum FP-91666 SS1] gi|389749598|gb|EIM90769.1| hypothetical protein STEHIDRAFT_50135, partial [Stereum hirsutum FP-91666 SS1] Length = 78 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/69 (50%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = +1 Query: 82 FGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFD-VRRVMNLIQ 258 +GN +RGCGHYV +Y +G +TDC +PNCALS++H H+ + C C+R + +RV+NL Q Sbjct: 1 YGNMYRGCGHYVILYRTGNRTDCMSPNCALSSQHQHRAVRYCNCSRHTNNSPQRVVNLFQ 60 Query: 259 EPCDECKEA 285 CD C+EA Sbjct: 61 TQCDLCQEA 69 >gb|EIW53988.1| hypothetical protein TRAVEDRAFT_131983, partial [Trametes versicolor FP-101664 SS1] Length = 82 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 1/69 (1%) Frame = +1 Query: 82 FGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQ-NCPCNRRYFDVRRVMNLIQ 258 FGN HR C HYV +Y SG +TDC +P+CALS H H+ Q C C R + RRV+NLI Sbjct: 1 FGNYHRKCEHYVKMYESGNKTDCGSPSCALSKAHKHRPGQRTCTCARIPRECRRVLNLIH 60 Query: 259 EPCDECKEA 285 + CDEC A Sbjct: 61 DRCDECTRA 69 >ref|XP_007399117.1| hypothetical protein PHACADRAFT_261410 [Phanerochaete carnosa HHB-10118-sp] gi|409043302|gb|EKM52785.1| hypothetical protein PHACADRAFT_261410 [Phanerochaete carnosa HHB-10118-sp] Length = 78 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/74 (41%), Positives = 44/74 (59%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E G+ +RGC H+ YY+G DC+ NC S+ H+HKT + C C ++RRV Sbjct: 1 MCEHEVVGDYYRGCQHFHGRYYTGEVKDCKAENCKTSSNHVHKTVRRCDCPTVMTELRRV 60 Query: 244 MNLIQEPCDECKEA 285 N+IQ P ++C A Sbjct: 61 QNMIQMPHEDCAPA 74 >ref|XP_007322929.1| hypothetical protein SERLADRAFT_477549 [Serpula lacrymans var. lacrymans S7.9] gi|336366359|gb|EGN94706.1| hypothetical protein SERLA73DRAFT_187763 [Serpula lacrymans var. lacrymans S7.3] gi|336379028|gb|EGO20184.1| hypothetical protein SERLADRAFT_477549 [Serpula lacrymans var. lacrymans S7.9] Length = 75 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/71 (43%), Positives = 39/71 (54%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E G+ +RGCGH+ Y++G +DC C S HMHKT NC C + RRV Sbjct: 1 MCLHEIVGDYYRGCGHFHGRYFTGEMSDCNASRCKTSKSHMHKTAPNCGCPSVVTEDRRV 60 Query: 244 MNLIQEPCDEC 276 NL Q P +C Sbjct: 61 QNLYQTPHPDC 71 >gb|EUC64317.1| hypothetical protein RSOL_439070, partial [Rhizoctonia solani AG-3 Rhs1AP] Length = 85 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYF-DVRR 240 MC Q G QHRGCGHYV + S + DCE+P C S+KH R + CN Y D+++ Sbjct: 1 MCRQITEGTQHRGCGHYVLHWVSAIY-DCEDPKCNKSSKHSDNCRTHNTCNMEYGPDIQK 59 Query: 241 VMNLIQEPCDECK 279 + + EPC+ CK Sbjct: 60 ITAMNYEPCERCK 72 >gb|EPQ54258.1| hypothetical protein GLOTRDRAFT_27801, partial [Gloeophyllum trabeum ATCC 11539] Length = 57 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +1 Query: 109 HYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMNLIQEPCDECK 279 H V +YY+G +TDC + CALS+ HMHKT + C C+R D RV+NL Q CD CK Sbjct: 1 HNVVLYYTGNRTDCGSSTCALSSAHMHKTSKQCGCSRVIRDDCRVVNLFQTECDACK 57 >ref|XP_006455725.1| hypothetical protein AGABI2DRAFT_76734 [Agaricus bisporus var. bisporus H97] gi|597998337|ref|XP_007333977.1| hypothetical protein AGABI1DRAFT_80003 [Agaricus bisporus var. burnettii JB137-S8] gi|409075013|gb|EKM75399.1| hypothetical protein AGABI1DRAFT_80003 [Agaricus bisporus var. burnettii JB137-S8] gi|426193567|gb|EKV43500.1| hypothetical protein AGABI2DRAFT_76734 [Agaricus bisporus var. bisporus H97] Length = 76 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/72 (38%), Positives = 41/72 (56%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E G+ +RGCGH+ Y++G +DC+ C S KH H ++NC C + R+V Sbjct: 1 MCKHEVVGDYYRGCGHFHLRYFTGKVSDCDLTVCKTSKKHAHGNKKNCDCPEVIVEDRKV 60 Query: 244 MNLIQEPCDECK 279 NL Q P +C+ Sbjct: 61 ENLFQNPFSQCQ 72 >ref|XP_007386943.1| hypothetical protein PUNSTDRAFT_91335 [Punctularia strigosozonata HHB-11173 SS5] gi|390596352|gb|EIN05754.1| hypothetical protein PUNSTDRAFT_91335 [Punctularia strigosozonata HHB-11173 SS5] Length = 71 Score = 68.2 bits (165), Expect = 1e-09 Identities = 26/70 (37%), Positives = 42/70 (60%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E G+++ GCGH+V +Y +G TDC + +C S+ H HKT +NC C + R++ Sbjct: 1 MCEYEVVGDRYTGCGHFVALYETGEVTDCMSEDCKTSSAHKHKTAKNCGCPAVKWQRRKI 60 Query: 244 MNLIQEPCDE 273 N+ + C + Sbjct: 61 QNMFRTKCPD 70 >gb|EIW76834.1| hypothetical protein CONPUDRAFT_157988 [Coniophora puteana RWD-64-598 SS2] Length = 97 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/70 (42%), Positives = 37/70 (52%) Frame = +1 Query: 70 SQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMN 249 S G+ +RGCGH+ Y +G TDC C S HMHKT NC C + RRV N Sbjct: 24 SSRSIGDYYRGCGHFHGRYETGEITDCGQAKCKTSKSHMHKTAPNCGCPTVMSEDRRVQN 83 Query: 250 LIQEPCDECK 279 L Q P +C+ Sbjct: 84 LYQTPYPDCQ 93 >ref|XP_001880055.1| predicted protein [Laccaria bicolor S238N-H82] gi|164645458|gb|EDR09706.1| predicted protein [Laccaria bicolor S238N-H82] Length = 77 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/72 (38%), Positives = 37/72 (51%) Frame = +1 Query: 64 MCSQECFGNQHRGCGHYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRV 243 MC E G+ +RGCGH+ YY+G DC + C S H HKT C C + RR+ Sbjct: 1 MCKHEIIGDYYRGCGHFHGKYYTGETMDCGSDCCKSSNSHKHKTANKCTCPEIIIEDRRI 60 Query: 244 MNLIQEPCDECK 279 NL Q +C+ Sbjct: 61 QNLFQTHHADCQ 72 >gb|EPT02432.1| hypothetical protein FOMPIDRAFT_1087248, partial [Fomitopsis pinicola FP-58527 SS1] Length = 57 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +1 Query: 109 HYVTIYYSGVQTDCENPNCALSTKHMHKTRQNCPCNRRYFDVRRVMNLIQEPCDECK 279 HYV Y SGV+ DC +P C LS H H RQ C C + Y + +R+MNLI+ CD CK Sbjct: 1 HYVKQYESGVKKDCGSPTCGLSKAHKHTARQ-CGCPKVYQEEQRIMNLIRYYCDACK 56