BLASTX nr result
ID: Paeonia25_contig00045290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045290 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM03497.1| predicted protein [Fibroporia radiculosa] 59 5e-07 >emb|CCM03497.1| predicted protein [Fibroporia radiculosa] Length = 85 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/61 (52%), Positives = 42/61 (68%), Gaps = 4/61 (6%) Frame = -1 Query: 173 MSFISADDTSGWG---AGPSQEVSI-KDTLRKDKLVSDIISVQENLRALLTKSRSVQDDV 6 MS+ + DD+ GWG A PS I +D +RKD+LV +I+S QENLRALL + + VQ DV Sbjct: 1 MSYSAFDDSPGWGVLEADPSSSGDIIQDAIRKDQLVKEIVSAQENLRALLERVKGVQGDV 60 Query: 5 D 3 D Sbjct: 61 D 61