BLASTX nr result
ID: Paeonia25_contig00045092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00045092 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD40262.1| hypothetical protein CERSUDRAFT_110868 [Ceriporio... 60 2e-07 >gb|EMD40262.1| hypothetical protein CERSUDRAFT_110868 [Ceriporiopsis subvermispora B] Length = 816 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 95 MKDGKQRARPESTSRGTYTKQACNHCRRRKS 3 MK+GKQRA+PES SRGTYTKQACNHCRRRKS Sbjct: 1 MKEGKQRAKPES-SRGTYTKQACNHCRRRKS 30