BLASTX nr result
ID: Paeonia25_contig00044846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044846 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19389.3| unnamed protein product [Vitis vinifera] 132 6e-29 ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containi... 132 6e-29 ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containi... 126 3e-27 ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containi... 125 5e-27 ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prun... 124 1e-26 ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citr... 123 2e-26 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 120 3e-25 ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containi... 120 3e-25 ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phas... 116 4e-24 ref|XP_004485985.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_006352669.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-23 ref|XP_003546072.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 gb|EYU40638.1| hypothetical protein MIMGU_mgv1a007674mg [Mimulus... 110 2e-22 ref|XP_006594515.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_004242426.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 gb|EXB84488.1| hypothetical protein L484_015819 [Morus notabilis] 108 6e-22 ref|XP_003593879.1| Pentatricopeptide repeat-containing protein ... 107 1e-21 ref|XP_002534359.1| pentatricopeptide repeat-containing protein,... 107 2e-21 ref|XP_007049649.1| Tetratricopeptide repeat (TPR)-like superfam... 102 4e-20 ref|XP_006418648.1| hypothetical protein EUTSA_v10002564mg [Eutr... 100 2e-19 >emb|CBI19389.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 132 bits (331), Expect = 6e-29 Identities = 63/83 (75%), Positives = 74/83 (89%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +IL CSLS+ERRFE+AT ++FDML S+APDLLTYKTLLEGL REGK NDAF+LLE+LRK Sbjct: 283 VILICSLSMERRFEEATKILFDMLGNSMAPDLLTYKTLLEGLSREGKCNDAFELLEDLRK 342 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 KD +MGEKTYKTL+ G+HFL QE Sbjct: 343 KDAWMGEKTYKTLVKGLHFLSQE 365 >ref|XP_002283378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Vitis vinifera] Length = 393 Score = 132 bits (331), Expect = 6e-29 Identities = 63/83 (75%), Positives = 74/83 (89%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +IL CSLS+ERRFE+AT ++FDML S+APDLLTYKTLLEGL REGK NDAF+LLE+LRK Sbjct: 311 VILICSLSMERRFEEATKILFDMLGNSMAPDLLTYKTLLEGLSREGKCNDAFELLEDLRK 370 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 KD +MGEKTYKTL+ G+HFL QE Sbjct: 371 KDAWMGEKTYKTLVKGLHFLSQE 393 >ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 370 Score = 126 bits (317), Expect = 3e-27 Identities = 58/83 (69%), Positives = 72/83 (86%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 M++ CSL++ERR+EDA+DVVFDMLS SV+PDLLTYKTLLEGLCR+GKG +AFDLLE R Sbjct: 288 MVVICSLALERRYEDASDVVFDMLSNSVSPDLLTYKTLLEGLCRDGKGEEAFDLLENFRS 347 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D M E+TYKTLLN +HF+ +E Sbjct: 348 RDRAMNERTYKTLLNALHFINKE 370 >ref|XP_006484804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Citrus sinensis] Length = 388 Score = 125 bits (315), Expect = 5e-27 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++ERRFEDA +V+FDML S+ PD+LTYKTLLEGLCREG+ ++AFDLLEE RK Sbjct: 306 MILICSLALERRFEDALEVLFDMLGNSMGPDMLTYKTLLEGLCREGRESEAFDLLEEFRK 365 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MG++ YKTLLNG+HF QE Sbjct: 366 RDVVMGDRNYKTLLNGLHFQNQE 388 >ref|XP_007199919.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] gi|462395319|gb|EMJ01118.1| hypothetical protein PRUPE_ppa006910mg [Prunus persica] Length = 390 Score = 124 bits (311), Expect = 1e-26 Identities = 57/80 (71%), Positives = 72/80 (90%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MI+ CSL++ERR++DA++VV DMLS S++PDLLTYKTLLEGLCR+GKG++AFDLLE+ RK Sbjct: 308 MIVICSLAMERRYDDASEVVLDMLSNSMSPDLLTYKTLLEGLCRDGKGSEAFDLLEDFRK 367 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 D MGEKTYKTLLN +HF+ Sbjct: 368 GDSKMGEKTYKTLLNALHFV 387 >ref|XP_006437247.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] gi|557539443|gb|ESR50487.1| hypothetical protein CICLE_v10031787mg [Citrus clementina] Length = 388 Score = 123 bits (309), Expect = 2e-26 Identities = 57/83 (68%), Positives = 70/83 (84%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++E RFEDA +V+FDML S+ PD+LTYKTLLEGLCREG+ ++AFDLLEE RK Sbjct: 306 MILICSLALESRFEDALEVLFDMLGNSMGPDMLTYKTLLEGLCREGRESEAFDLLEEFRK 365 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MG++ YKTLLNG+HF QE Sbjct: 366 RDVVMGDRNYKTLLNGLHFQNQE 388 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gi|550345772|gb|EEE81080.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] Length = 387 Score = 120 bits (300), Expect = 3e-25 Identities = 57/83 (68%), Positives = 70/83 (84%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL +ERRFE+A VVFDML S++PDLLTY+T+LEGLCREG + AF+LLEE RK Sbjct: 305 MILICSLGMERRFEEAIGVVFDMLGDSMSPDLLTYRTVLEGLCREGMVDKAFELLEEWRK 364 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 KD FMGEK YK+LLNG+HF+ ++ Sbjct: 365 KDGFMGEKNYKSLLNGLHFVSRQ 387 >ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] gi|449516331|ref|XP_004165200.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] Length = 393 Score = 120 bits (300), Expect = 3e-25 Identities = 55/78 (70%), Positives = 69/78 (88%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++ERRFE+A ++ FDML S+APDLLTY+TLLEGLCREG+ ++AFDLL+ELRK Sbjct: 311 MILICSLAMERRFEEAIEICFDMLCNSMAPDLLTYRTLLEGLCREGRDSEAFDLLDELRK 370 Query: 182 KDCFMGEKTYKTLLNGIH 235 +D M EKT+KTLLNG+H Sbjct: 371 RDKLMNEKTFKTLLNGLH 388 >ref|XP_007147943.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] gi|561021166|gb|ESW19937.1| hypothetical protein PHAVU_006G167600g [Phaseolus vulgaris] Length = 373 Score = 116 bits (290), Expect = 4e-24 Identities = 53/83 (63%), Positives = 70/83 (84%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +I+ CSL++ERRFE+A +VVFDML +S +PD LTYKT+LEGLCREG+ +DAF+LL+E +K Sbjct: 291 VIIVCSLAMERRFEEAIEVVFDMLGQSRSPDHLTYKTVLEGLCREGRVDDAFELLDECKK 350 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MGEK YKTLL +HF C+E Sbjct: 351 RDASMGEKMYKTLLEDLHFSCRE 373 >ref|XP_004485985.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cicer arietinum] Length = 369 Score = 114 bits (284), Expect = 2e-23 Identities = 51/83 (61%), Positives = 69/83 (83%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +I+ CSL++ERRFEDA +V+FDML S +PD LTYKT+LEGLCREG+ +DAF+LL+E +K Sbjct: 287 VIIVCSLALERRFEDAIEVMFDMLDNSRSPDHLTYKTVLEGLCREGRVDDAFELLDECKK 346 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D FM EK YKTL N + F+C++ Sbjct: 347 RDGFMNEKMYKTLFNDLRFVCRD 369 >ref|XP_006352669.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Solanum tuberosum] Length = 379 Score = 113 bits (282), Expect = 3e-23 Identities = 53/80 (66%), Positives = 68/80 (85%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++ERRFEDAT+VVFDML S++PD LTYKT++E L REG+G+ AF+LLEE +K Sbjct: 297 MILVCSLALERRFEDATEVVFDMLDNSLSPDQLTYKTVMEELSREGRGDYAFELLEEFKK 356 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 +D M EKTYK+LLN ++FL Sbjct: 357 RDSLMNEKTYKSLLNTLYFL 376 >ref|XP_003546072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Glycine max] Length = 372 Score = 112 bits (281), Expect = 4e-23 Identities = 50/83 (60%), Positives = 72/83 (86%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +I+ CSL++ERRFEDA +V+FDML +S +PD LTYKT+LEGLCREG+ ++AF+LL+E +K Sbjct: 290 VIIVCSLAMERRFEDAIEVLFDMLGQSRSPDHLTYKTVLEGLCREGRVDEAFELLDECKK 349 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MGEKTYK+LLN ++ +C++ Sbjct: 350 RDVSMGEKTYKSLLNDLYVVCRD 372 >gb|EYU40638.1| hypothetical protein MIMGU_mgv1a007674mg [Mimulus guttatus] Length = 399 Score = 110 bits (276), Expect = 2e-22 Identities = 47/80 (58%), Positives = 67/80 (83%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 M+L C L++ER+F+D+ + FDML+ S++PDLLTYKTLLE +CR+GKG++AF+LL+ RK Sbjct: 316 MVLICGLAMERKFQDSIETAFDMLANSMSPDLLTYKTLLEEMCRDGKGDEAFELLDAFRK 375 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 +D FM E+TY TLL+ +HFL Sbjct: 376 RDTFMNERTYNTLLSALHFL 395 >ref|XP_006594515.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Glycine max] Length = 375 Score = 110 bits (276), Expect = 2e-22 Identities = 49/83 (59%), Positives = 71/83 (85%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +I+ CSL++ERR EDA +++FDML +S +PD LTYKT+LEGLCREG+ ++AF+LL+E +K Sbjct: 293 VIIVCSLAMERRLEDAIELLFDMLGQSRSPDHLTYKTVLEGLCREGRVDEAFELLDECKK 352 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MGEKTYK+LLN ++ +C+E Sbjct: 353 RDVSMGEKTYKSLLNDLYVICRE 375 >ref|XP_004242426.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Solanum lycopersicum] Length = 403 Score = 110 bits (275), Expect = 2e-22 Identities = 51/80 (63%), Positives = 68/80 (85%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++ERRFEDA++VVFDML S++PD LTY+T++E L REG+G+ AF+LLEE +K Sbjct: 321 MILVCSLALERRFEDASEVVFDMLDNSLSPDQLTYRTVMEELSREGRGDYAFELLEEFKK 380 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 +D M EKTYK+LLN ++FL Sbjct: 381 RDSLMNEKTYKSLLNTLYFL 400 >gb|EXB84488.1| hypothetical protein L484_015819 [Morus notabilis] Length = 395 Score = 108 bits (271), Expect = 6e-22 Identities = 51/83 (61%), Positives = 66/83 (79%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++ERRF+D +V+ DML ++PDLLTYKTLLEGLCR+GKG++A LLEE R Sbjct: 310 MILICSLALERRFDDGVEVLRDMLDCKMSPDLLTYKTLLEGLCRDGKGDEALRLLEEFRG 369 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D MG KTY+ LLN +HF+ +E Sbjct: 370 RDGLMGGKTYRILLNELHFISRE 392 >ref|XP_003593879.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482927|gb|AES64130.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 360 Score = 107 bits (268), Expect = 1e-21 Identities = 47/83 (56%), Positives = 67/83 (80%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 +I+ CSL++ERRFEDA +V+FDML S +PD LTYKT+LEGLC EG+ ++AF+LL+E +K Sbjct: 278 VIIVCSLALERRFEDAIEVMFDMLGNSRSPDCLTYKTVLEGLCHEGRVDEAFELLDEFKK 337 Query: 182 KDCFMGEKTYKTLLNGIHFLCQE 250 +D M E+ YKTL N + F+C++ Sbjct: 338 RDVGMNERMYKTLFNDLQFVCRD 360 >ref|XP_002534359.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525434|gb|EEF28024.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 382 Score = 107 bits (266), Expect = 2e-21 Identities = 49/80 (61%), Positives = 65/80 (81%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL+++ R +A DVVFDML+ S++PD LTY+T+LEGLCREGK ++AF+LLEE RK Sbjct: 300 MILICSLAVDLRLGEAIDVVFDMLANSMSPDFLTYRTVLEGLCREGKTDEAFELLEEFRK 359 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 +D M +KTYK LLN + F+ Sbjct: 360 RDMSMSQKTYKILLNALQFV 379 >ref|XP_007049649.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508701910|gb|EOX93806.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 382 Score = 102 bits (255), Expect = 4e-20 Identities = 46/78 (58%), Positives = 63/78 (80%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 MIL CSL++E+R +DA DVV DML+ S+APDLLTYKT+LE CR G+ +DAF+LLE+ +K Sbjct: 302 MILICSLAMEQRLDDAVDVVSDMLANSMAPDLLTYKTVLEEFCRRGRSHDAFELLEDWKK 361 Query: 182 KDCFMGEKTYKTLLNGIH 235 +D MG+K Y+ L+N +H Sbjct: 362 RDLSMGQKNYRILVNALH 379 >ref|XP_006418648.1| hypothetical protein EUTSA_v10002564mg [Eutrema salsugineum] gi|557096576|gb|ESQ37084.1| hypothetical protein EUTSA_v10002564mg [Eutrema salsugineum] Length = 384 Score = 100 bits (250), Expect = 2e-19 Identities = 43/80 (53%), Positives = 66/80 (82%) Frame = +2 Query: 2 MILTCSLSIERRFEDATDVVFDMLSKSVAPDLLTYKTLLEGLCREGKGNDAFDLLEELRK 181 M+L CSL++ERR +A +VV++ML+ S++PD+LTY T+L LCREG+GN+A +LLEE +K Sbjct: 302 MVLICSLAMERRLSEAVEVVYEMLANSLSPDMLTYNTVLAELCREGRGNEALELLEEWKK 361 Query: 182 KDCFMGEKTYKTLLNGIHFL 241 +D MGE+ Y+TL++ ++FL Sbjct: 362 RDPVMGERNYRTLMDEVYFL 381