BLASTX nr result
ID: Paeonia25_contig00044838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044838 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007339190.1| peptidyl-tRNA hydrolase [Auricularia delicat... 57 3e-06 >ref|XP_007339190.1| peptidyl-tRNA hydrolase [Auricularia delicata TFB-10046 SS5] gi|393244945|gb|EJD52456.1| peptidyl-tRNA hydrolase [Auricularia delicata TFB-10046 SS5] Length = 218 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -3 Query: 148 KILVVGLGNITHPGTRHSAGHMIIESIAAHLDIALRKNHDWNGVSGQKS 2 KI++VGLGNITHPGTRHS GH I++++A HL + + N G S Sbjct: 18 KIMIVGLGNITHPGTRHSVGHHIVDALANHLGARMNMDRATNSWIGHAS 66