BLASTX nr result
ID: Paeonia25_contig00044812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044812 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528457.1| actin depolymerizing factor, putative [Ricin... 43 1e-06 gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Mimulus... 42 9e-06 >ref|XP_002528457.1| actin depolymerizing factor, putative [Ricinus communis] gi|223532133|gb|EEF33940.1| actin depolymerizing factor, putative [Ricinus communis] Length = 139 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -3 Query: 249 VESSSLHGLQRDLNGIQIELQATDPTDMGTNVI*SCS 139 + +SS +R+L+GIQ+ELQATDPT+MG +VI S S Sbjct: 102 IYASSKDRFKRELDGIQVELQATDPTEMGLDVIRSRS 138 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -2 Query: 301 RYAVSNFDFMTKETF*RSGIVFIAWS 224 RYAV +FD++T E +S IVFIAWS Sbjct: 66 RYAVYDFDYVTDENCQKSRIVFIAWS 91 >gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Mimulus guttatus] Length = 139 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 19/33 (57%), Positives = 27/33 (81%) Frame = -3 Query: 249 VESSSLHGLQRDLNGIQIELQATDPTDMGTNVI 151 + +SS +R+L+GIQ+ELQATDPT+MG +VI Sbjct: 102 IYASSKDRFKRELDGIQVELQATDPTEMGLDVI 134 Score = 32.7 bits (73), Expect(2) = 9e-06 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 301 RYAVSNFDFMTKETF*RSGIVFIAWS 224 RY V +FDF+T E +S I FIAWS Sbjct: 66 RYTVYDFDFVTAENCQKSKIFFIAWS 91