BLASTX nr result
ID: Paeonia25_contig00044789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044789 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007223344.1| hypothetical protein PRUPE_ppa009543mg [Prun... 59 7e-07 >ref|XP_007223344.1| hypothetical protein PRUPE_ppa009543mg [Prunus persica] gi|462420280|gb|EMJ24543.1| hypothetical protein PRUPE_ppa009543mg [Prunus persica] Length = 287 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 MDLPTLINEGSFSSANGTSYNLAEIWPFPINGGGS 1 MD PTL+NE SFS+AN TS+NL+EIW FP+NGGG+ Sbjct: 1 MDPPTLVNECSFSNANATSFNLSEIWQFPMNGGGA 35