BLASTX nr result
ID: Paeonia25_contig00044705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044705 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007379520.1| hypothetical protein PUNSTDRAFT_96574 [Punct... 80 4e-13 emb|CCM01847.1| predicted protein [Fibroporia radiculosa] 77 2e-12 ref|XP_002471987.1| predicted protein [Postia placenta Mad-698-R... 77 2e-12 ref|XP_002474728.1| predicted protein [Postia placenta Mad-698-R... 77 2e-12 gb|EPT02010.1| hypothetical protein FOMPIDRAFT_1160886 [Fomitops... 77 3e-12 gb|EIW55527.1| hypothetical protein TRAVEDRAFT_38771 [Trametes v... 74 2e-11 ref|XP_007363579.1| hypothetical protein DICSQDRAFT_153682 [Dich... 74 2e-11 ref|XP_007394911.1| hypothetical protein PHACADRAFT_254636 [Phan... 73 5e-11 ref|XP_007303592.1| hypothetical protein STEHIDRAFT_120974 [Ster... 73 5e-11 ref|XP_002911004.1| hypothetical protein CC1G_15545 [Coprinopsis... 72 8e-11 ref|XP_001887314.1| predicted protein [Laccaria bicolor S238N-H8... 72 8e-11 ref|XP_002396881.1| hypothetical protein MPER_02794 [Moniliophth... 71 1e-10 gb|ESK85664.1| hypothetical protein Moror_9933 [Moniliophthora r... 71 2e-10 ref|XP_003031368.1| hypothetical protein SCHCODRAFT_56434 [Schiz... 70 2e-10 gb|EPQ51831.1| hypothetical protein GLOTRDRAFT_48104 [Gloeophyll... 70 4e-10 ref|XP_006455439.1| hypothetical protein AGABI2DRAFT_209903 [Aga... 68 2e-09 ref|XP_007333488.1| hypothetical protein AGABI1DRAFT_131825 [Aga... 68 2e-09 gb|ETW77331.1| hypothetical protein HETIRDRAFT_460594 [Heterobas... 67 2e-09 ref|XP_007315191.1| hypothetical protein SERLADRAFT_459933 [Serp... 67 3e-09 ref|XP_007263464.1| hypothetical protein FOMMEDRAFT_78728 [Fomit... 64 2e-08 >ref|XP_007379520.1| hypothetical protein PUNSTDRAFT_96574 [Punctularia strigosozonata HHB-11173 SS5] gi|390605212|gb|EIN14603.1| hypothetical protein PUNSTDRAFT_96574 [Punctularia strigosozonata HHB-11173 SS5] Length = 318 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 MEGLPIDTSHPAVRDYL+L+RLQVLTPLSLLINIATVMVC+ Sbjct: 1 MEGLPIDTSHPAVRDYLSLIRLQVLTPLSLLINIATVMVCT 41 >emb|CCM01847.1| predicted protein [Fibroporia radiculosa] Length = 352 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = -3 Query: 153 KLTFYTIVYTMEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 K T + ME LPIDT+HPAVRDYLAL+RLQVLTPLSLLINIATV+VCS Sbjct: 33 KSTRFPGAQMMESLPIDTAHPAVRDYLALIRLQVLTPLSLLINIATVVVCS 83 >ref|XP_002471987.1| predicted protein [Postia placenta Mad-698-R] gi|220728911|gb|EED82795.1| predicted protein [Postia placenta Mad-698-R] Length = 298 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LPIDTSHPAVRDYLAL+RLQVLTPLSLLINIATV+VC+ Sbjct: 2 MESLPIDTSHPAVRDYLALIRLQVLTPLSLLINIATVIVCA 42 >ref|XP_002474728.1| predicted protein [Postia placenta Mad-698-R] gi|220726091|gb|EED80052.1| predicted protein [Postia placenta Mad-698-R] Length = 298 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LPIDTSHPAVRDYLAL+RLQVLTPLSLLINIATV+VC+ Sbjct: 2 MESLPIDTSHPAVRDYLALIRLQVLTPLSLLINIATVIVCA 42 >gb|EPT02010.1| hypothetical protein FOMPIDRAFT_1160886 [Fomitopsis pinicola FP-58527 SS1] Length = 319 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LPIDTSHPAVR+YLAL+RLQVLTPLSLL+NIATVMVC+ Sbjct: 2 MENLPIDTSHPAVREYLALIRLQVLTPLSLLVNIATVMVCT 42 >gb|EIW55527.1| hypothetical protein TRAVEDRAFT_38771 [Trametes versicolor FP-101664 SS1] Length = 312 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LPIDT+HPAVR+YLAL+RLQVLTPLSLLINIAT+MVC+ Sbjct: 2 MEDLPIDTNHPAVREYLALIRLQVLTPLSLLINIATLMVCT 42 >ref|XP_007363579.1| hypothetical protein DICSQDRAFT_153682 [Dichomitus squalens LYAD-421 SS1] gi|395331480|gb|EJF63861.1| hypothetical protein DICSQDRAFT_153682 [Dichomitus squalens LYAD-421 SS1] Length = 316 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LP+DTSHPAV++YLALVRLQVLTPLSLL+NIAT+MVC+ Sbjct: 1 MESLPLDTSHPAVKEYLALVRLQVLTPLSLLVNIATLMVCT 41 >ref|XP_007394911.1| hypothetical protein PHACADRAFT_254636 [Phanerochaete carnosa HHB-10118-sp] gi|409047605|gb|EKM57084.1| hypothetical protein PHACADRAFT_254636 [Phanerochaete carnosa HHB-10118-sp] Length = 309 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 114 LPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 LP+DTSHPAVRDYLALVRLQ+LTPLSLLIN+ATVMVC+ Sbjct: 6 LPLDTSHPAVRDYLALVRLQILTPLSLLINMATVMVCT 43 >ref|XP_007303592.1| hypothetical protein STEHIDRAFT_120974 [Stereum hirsutum FP-91666 SS1] gi|389746144|gb|EIM87324.1| hypothetical protein STEHIDRAFT_120974 [Stereum hirsutum FP-91666 SS1] Length = 309 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+DT HPAVRDYL+L+RLQVLTPLSLLINIATVM+C+ Sbjct: 1 MDDLPLDTHHPAVRDYLSLIRLQVLTPLSLLINIATVMICA 41 >ref|XP_002911004.1| hypothetical protein CC1G_15545 [Coprinopsis cinerea okayama7#130] gi|298406905|gb|EFI27510.1| hypothetical protein CC1G_15545 [Coprinopsis cinerea okayama7#130] Length = 332 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+DTSHPAVRDYL+LVRLQVLTPLSLLINIA V+VC+ Sbjct: 1 MDALPLDTSHPAVRDYLSLVRLQVLTPLSLLINIACVIVCA 41 >ref|XP_001887314.1| predicted protein [Laccaria bicolor S238N-H82] gi|164637640|gb|EDR01923.1| predicted protein [Laccaria bicolor S238N-H82] Length = 326 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+DTSHPAVR+YL+LVRLQVLTPLSLLINIAT+ VC+ Sbjct: 1 MDALPVDTSHPAVREYLSLVRLQVLTPLSLLINIATIAVCA 41 >ref|XP_002396881.1| hypothetical protein MPER_02794 [Moniliophthora perniciosa FA553] gi|215470255|gb|EEB97811.1| hypothetical protein MPER_02794 [Moniliophthora perniciosa FA553] Length = 182 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/41 (78%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 MEGLPID SHP+VR+YL+L+RLQVLTPLSLLINIA+++VC+ Sbjct: 1 MEGLPIDMSHPSVREYLSLIRLQVLTPLSLLINIASIIVCA 41 >gb|ESK85664.1| hypothetical protein Moror_9933 [Moniliophthora roreri MCA 2997] Length = 322 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 40/41 (97%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 MEGLPID SHP+VR+YL+L+RLQVLTPLSLLINIA++++C+ Sbjct: 1 MEGLPIDMSHPSVREYLSLIRLQVLTPLSLLINIASIIICA 41 >ref|XP_003031368.1| hypothetical protein SCHCODRAFT_56434 [Schizophyllum commune H4-8] gi|300105060|gb|EFI96465.1| hypothetical protein SCHCODRAFT_56434 [Schizophyllum commune H4-8] Length = 335 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 120 EGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 + LPID SHPAVRDYLALVRLQVLTPLSLLIN+ATV++C+ Sbjct: 3 DDLPIDFSHPAVRDYLALVRLQVLTPLSLLINVATVIICA 42 >gb|EPQ51831.1| hypothetical protein GLOTRDRAFT_48104 [Gloeophyllum trabeum ATCC 11539] Length = 310 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 ME LP+D SHPAVRDYL L+RLQVLTPLSL+IN+ATV+VC+ Sbjct: 1 MESLPLDPSHPAVRDYLHLIRLQVLTPLSLVINMATVLVCT 41 >ref|XP_006455439.1| hypothetical protein AGABI2DRAFT_209903 [Agaricus bisporus var. bisporus H97] gi|426194246|gb|EKV44178.1| hypothetical protein AGABI2DRAFT_209903 [Agaricus bisporus var. bisporus H97] Length = 315 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+DT+HPAVR+YLAL RLQVLTPLSL+IN+AT +VC+ Sbjct: 1 MDALPLDTNHPAVREYLALTRLQVLTPLSLVINLATFLVCA 41 >ref|XP_007333488.1| hypothetical protein AGABI1DRAFT_131825 [Agaricus bisporus var. burnettii JB137-S8] gi|409075548|gb|EKM75927.1| hypothetical protein AGABI1DRAFT_131825 [Agaricus bisporus var. burnettii JB137-S8] Length = 318 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+DT+HPAVR+YLAL RLQVLTPLSL+IN+AT +VC+ Sbjct: 1 MDALPLDTNHPAVREYLALTRLQVLTPLSLVINLATFLVCA 41 >gb|ETW77331.1| hypothetical protein HETIRDRAFT_460594 [Heterobasidion irregulare TC 32-1] Length = 308 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+D HPAVRD+L+L+RLQVLTPLSLL+NIATV++CS Sbjct: 1 MDELPLDMLHPAVRDHLSLIRLQVLTPLSLLVNIATVLICS 41 >ref|XP_007315191.1| hypothetical protein SERLADRAFT_459933 [Serpula lacrymans var. lacrymans S7.9] gi|336363981|gb|EGN92348.1| hypothetical protein SERLA73DRAFT_191309 [Serpula lacrymans var. lacrymans S7.3] gi|336385954|gb|EGO27100.1| hypothetical protein SERLADRAFT_459933 [Serpula lacrymans var. lacrymans S7.9] Length = 311 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M+ LP+D S+PAV++YL+LVRLQVLTPLSLLINIATV+VC+ Sbjct: 1 MDSLPVDMSNPAVQEYLSLVRLQVLTPLSLLINIATVLVCT 41 >ref|XP_007263464.1| hypothetical protein FOMMEDRAFT_78728 [Fomitiporia mediterranea MF3/22] gi|393219832|gb|EJD05318.1| hypothetical protein FOMMEDRAFT_78728 [Fomitiporia mediterranea MF3/22] Length = 255 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 123 MEGLPIDTSHPAVRDYLALVRLQVLTPLSLLINIATVMVCS 1 M LPIDTS+PAVRD+L L RLQVLTPLSLLINIA V VC+ Sbjct: 1 MPDLPIDTSNPAVRDFLMLTRLQVLTPLSLLINIAAVCVCT 41