BLASTX nr result
ID: Paeonia25_contig00044594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044594 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS96977.1| hypothetical protein FOMPIDRAFT_92556 [Fomitopsis... 55 8e-06 >gb|EPS96977.1| hypothetical protein FOMPIDRAFT_92556 [Fomitopsis pinicola FP-58527 SS1] Length = 1546 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 352 WQGLSDRMDRLEHNFSCDDLNNQFKALPRLPSEDDAFVTFD 230 WQGLS+RMD+LE NF + + KALPRLPSEDDA+ D Sbjct: 740 WQGLSERMDKLEENFVSESSTLRVKALPRLPSEDDAYDAMD 780