BLASTX nr result
ID: Paeonia25_contig00044558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00044558 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68408.1| hypothetical protein VITISV_022912 [Vitis vinifera] 50 4e-06 >emb|CAN68408.1| hypothetical protein VITISV_022912 [Vitis vinifera] Length = 311 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -1 Query: 179 IVCS*FPDGLLEACIYVALKEILKGLSHLYGLNKLHREVNTKHIFFDKSCVDPTAIK 9 I+ S FP+G E C+ +AL+E LKGLS+++ + +LH+ V+ ++IF C AIK Sbjct: 115 IISSRFPEGFPEECVRIALRETLKGLSYIHRMGQLHKNVDARYIFL---CPYTPAIK 168 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -3 Query: 297 QKLKQAIESNT------HKNFMRRCLYFSENNVFNVLMPRMTGSSHSVFLISRW 154 QKLKQ ++ + H N +R F+ + V+MP M G S + SR+ Sbjct: 67 QKLKQELQHSAFLAGHPHPNIIRIKTEFAVGDNLYVVMPFMAGGSLQSIISSRF 120